y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g14650.1
FamilyAA2
Protein PropertiesLength: 497 Molecular Weight: 50391.3 Isoelectric Point: 9.0097
ChromosomeChromosome/Scaffold: 5 Start: 18074687 End: 18078214
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA22314790
  GKLLRMVFHDCFVEGCDASVLIEGSGTERTDPANLSLGGFNVIDEAKRLLEAVCPATVSCSDIIVLAARDAVTYTGGPSVPVSLGRRDSLVSLASNVRAN
  IIDTGFSVDAMAASFASKGLTLDDLVTLSGGHTIGSAHCGTFRERFHPDANGSMVPVDASMNTDYANELMQTCSSGNSTVTVDCDEGSAKVFDNRYFSNL
  LDGRGLLRTDAVLVQNATTRAKVSAFAQSQESFFASWAGSYARLTSLGV
Full Sequence
Protein Sequence     Length: 497     Download
MGTGRRPQWG VMFMCLALVL SALAAVASSQ SPLPAPPARR AAVPSFPPAA SRAPKRASGP    60
ALSPAPKPAS PPSASPAPKP TPRPAASPAP KPSSPLPAPK PPSPPAPAQA PKPSAPPAAS    120
PVPKPPSPPP MPSPSRAPKP SPSAPAPAPA QKPSPAPAPA PKASPPTTTP TPVLKPSVPS    180
PAPPPSPANS APPTSSPALS PSFYAASCPS VELAVNDVVR SASTLDPTIP GKLLRMVFHD    240
CFVEGCDASV LIEGSGTERT DPANLSLGGF NVIDEAKRLL EAVCPATVSC SDIIVLAARD    300
AVTYTGGPSV PVSLGRRDSL VSLASNVRAN IIDTGFSVDA MAASFASKGL TLDDLVTLSG    360
GHTIGSAHCG TFRERFHPDA NGSMVPVDAS MNTDYANELM QTCSSGNSTV TVDCDEGSAK    420
VFDNRYFSNL LDGRGLLRTD AVLVQNATTR AKVSAFAQSQ ESFFASWAGS YARLTSLGVK    480
TGSDGEIRRL CSSVNG*                                                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.000242945931+
cd00314plant_peroxidase_like1.0e-21214476298+
pfam00141peroxidase3.0e-56215364151+
PLN03030PLN030302.0e-80203495301+
cd00693secretory_peroxidase2.0e-135203494296+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACR34255.10187496169484unknown [Zea mays]
GenBankEAY94719.1024549652307hypothetical protein OsI_16496 [Oryza sativa Indica Group]
GenBankEEC71855.10244496481775hypothetical protein OsI_04549 [Oryza sativa Indica Group]
RefSeqNP_001053214.10199496207508Os04g0498700 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002448121.10146496124498hypothetical protein SORBIDRAFT_06g021550 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qgj_B01994952299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A01994952299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1bgp_A01914951305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1qo4_A01994963305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1pa2_A01994963305A Chain A, Arabidopsis Thaliana Peroxidase A2
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CD4399812462034440
CA2101702522364830
ES3004922342034320
BQ7885351692033710
BM1378131692033710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00365.1
Arabidopsis lyrata328551481340
Arabidopsis thalianaAT4G31760.1AT2G24800.1
Brassica rapaBra007831
Capsella rubellaCarubv10006533mCarubv10025481m
Citrus clementinaCiclev10008792m
Citrus sinensisorange1.1g019972m
Cucumis sativusCucsa.271330.1
Eucalyptus grandisEucgr.C04029.1
Fragaria vescamrna14987.1-v1.0-hybrid
Glycine maxGlyma17g33730.2Glyma14g12170.1Glyma06g06350.1
Gossypium raimondiiGorai.001G039200.1Gorai.009G064700.2Gorai.009G064700.1Gorai.001G039200.2
Linum usitatissimumLus10026903Lus10020097
Malus domesticaMDP0000289293
Manihot esculentacassava4.1_011556m
Medicago truncatulaMedtr3g105790.1
Mimulus guttatusmgv1a021862m
Panicum virgatumPavirv00013823mPavirv00002787m
Phaseolus vulgarisPhvul.009G085800.1Phvul.001G043100.2Phvul.001G043100.1
Populus trichocarpaPotri.018G015500.1Potri.006G267400.1
Prunus persicappa025451m
Ricinus communis29848.m004502
Setaria italicaSi011734m
Selaginella moellendorffii106106
Sorghum bicolorSb06g021550.1
Thellungiella halophilaThhalv10025685mThhalv10000495m
Vitis viniferaGSVIVT01036009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny