y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g14887.1
FamilyGT59
Protein PropertiesLength: 483 Molecular Weight: 54722.7 Isoelectric Point: 9.638
ChromosomeChromosome/Scaffold: 5 Start: 18300931 End: 18304816
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT59374340
  YYISLAYVAALFPGAWATKVADALEPLCTPALLRSTNVIMAVVCGVLVHDLLLCIKPGISKAKATVYAILVALYPVHWFFTFLYYTDVASLAAVLAMYLY
  CLKKRFWVSAMFGVISILFRQTNAIWMLFFAANGAITYVQDLCHSDYVSHENNGLTDKSITEVSDLANKATAPGLRRRRKDRSITMKRVVSGSTKLHTSF
  TEEISDISFGLWNSKCKVLITFTPFVIVLVVFVAFIIWNGGIVLGAKEAHVVSPHFAQLLYFGLVSSAALLPWHFTPRRVSDLFRLCRKNKTFSLLAMLM
  ALGLSFVAVHFFSIAHPYLLADNRHYTFYIWRKVIQAHWMMKYILIPFYVYSWFSVINILGKSQTRVWVLSFIFSVALVLVPAPLVEFRYYTIPLVIL
Full Sequence
Protein Sequence     Length: 483     Download
MGSHDHHPSW PVSFNDSSLL QSQICLVMDS SLQFCRYYIS LAYVAALFPG AWATKVADAL    60
EPLCTPALLR STNVIMAVVC GVLVHDLLLC IKPGISKAKA TVYAILVALY PVHWFFTFLY    120
YTDVASLAAV LAMYLYCLKK RFWVSAMFGV ISILFRQTNA IWMLFFAANG AITYVQDLCH    180
SDYVSHENNG LTDKSITEVS DLANKATAPG LRRRRKDRSI TMKRVVSGST KLHTSFTEEI    240
SDISFGLWNS KCKVLITFTP FVIVLVVFVA FIIWNGGIVL GAKEAHVVSP HFAQLLYFGL    300
VSSAALLPWH FTPRRVSDLF RLCRKNKTFS LLAMLMALGL SFVAVHFFSI AHPYLLADNR    360
HYTFYIWRKV IQAHWMMKYI LIPFYVYSWF SVINILGKSQ TRVWVLSFIF SVALVLVPAP    420
LVEFRYYTIP LVILILNSPV IDNGKLLALG SVYAAADLFT LAMFLFRPFR WEHEPGTQRF    480
MW*                                                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG101.0e-6037433398+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE02937.3037482109529OSJNBa0014K14.9 [Oryza sativa (japonica cultivar-group)]
EMBLCAE05548.203748261506OSJNBb0116K07.1 [Oryza sativa (japonica cultivar-group)]
GenBankEAY94762.103748261462hypothetical protein OsI_16542 [Oryza sativa Indica Group]
GenBankEEE61284.103748261481hypothetical protein OsJ_15367 [Oryza sativa Japonica Group]
RefSeqNP_001053242.103748252497Os04g0503700 [Oryza sativa (japonica cultivar-group)]
Transmembrane Domains
StartEnd
3452
6789
102124
144166
255277
287309
329351
371393
405427
447469
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO874350311483580
CJ8640382102744830
JG9516732102744830
DR8071862052794830
FL7666542601844430
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2
Brassica rapaBra005722
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2
Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120
Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny