y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g14887.2
FamilyGT59
Protein PropertiesLength: 507 Molecular Weight: 57225.8 Isoelectric Point: 9.5962
ChromosomeChromosome/Scaffold: 5 Start: 18300931 End: 18304442
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT59244580
  VVPDPYMDEIFHVPQAQRYCRGDLLTWDPMITTPPGLYYISLAYVAALFPGAWATKVADALEPLCTPALLRSTNVIMAVVCGVLVHDLLLCIKPGISKAK
  ATVYAILVALYPVHWFFTFLYYTDVASLAAVLAMYLYCLKKRFWVSAMFGVISILFRQTNAIWMLFFAANGAITYVQDLCHSDYVSHENNGLTDKSITEV
  SDLANKATAPGLRRRRKDRSITMKRVVSGSTKLHTSFTEEISDISFGLWNSKCKVLITFTPFVIVLVVFVAFIIWNGGIVLGAKEAHVVSPHFAQLLYFG
  LVSSAALLPWHFTPRRVSDLFRLCRKNKTFSLLAMLMALGLSFVAVHFFSIAHPYLLADNRHYTFYIWRKVIQAHWMMKYILIPFYVYSWFSVINILGKS
  QTRVWVLSFIFSVALVLVPAPLVEFRYYTIPLVIL
Full Sequence
Protein Sequence     Length: 507     Download
MGRLVVAAAV AAWAIPIAAW VDSVVPDPYM DEIFHVPQAQ RYCRGDLLTW DPMITTPPGL    60
YYISLAYVAA LFPGAWATKV ADALEPLCTP ALLRSTNVIM AVVCGVLVHD LLLCIKPGIS    120
KAKATVYAIL VALYPVHWFF TFLYYTDVAS LAAVLAMYLY CLKKRFWVSA MFGVISILFR    180
QTNAIWMLFF AANGAITYVQ DLCHSDYVSH ENNGLTDKSI TEVSDLANKA TAPGLRRRRK    240
DRSITMKRVV SGSTKLHTSF TEEISDISFG LWNSKCKVLI TFTPFVIVLV VFVAFIIWNG    300
GIVLGAKEAH VVSPHFAQLL YFGLVSSAAL LPWHFTPRRV SDLFRLCRKN KTFSLLAMLM    360
ALGLSFVAVH FFSIAHPYLL ADNRHYTFYI WRKVIQAHWM MKYILIPFYV YSWFSVINIL    420
GKSQTRVWVL SFIFSVALVL VPAPLVEFRY YTIPLVILIL NSPVIDNGKL LALGSVYAAA    480
DLFTLAMFLF RPFRWEHEPG TQRFMW*                                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG101.0e-8724457435+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE02937.303150679529OSJNBa0014K14.9 [Oryza sativa (japonica cultivar-group)]
EMBLCAE05548.202750627506OSJNBb0116K07.1 [Oryza sativa (japonica cultivar-group)]
GenBankEAY94762.102750627462hypothetical protein OsI_16542 [Oryza sativa Indica Group]
GenBankEEE61284.102750627481hypothetical protein OsJ_15367 [Oryza sativa Japonica Group]
RefSeqNP_001053242.104450635497Os04g0503700 [Oryza sativa (japonica cultivar-group)]
Transmembrane Domains
StartEnd
421
5976
91113
126148
168190
279301
311333
353375
395417
429451
471493
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO874350311723820
JG9516732102985070
CJ8640382102985070
DR8071862053035070
FL7666542602084670
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.1
Brassica rapaBra005722
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2
Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120
Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny