y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g15097.1
FamilyGT29
Protein PropertiesLength: 356 Molecular Weight: 38509.6 Isoelectric Point: 7.4104
ChromosomeChromosome/Scaffold: 5 Start: 18483129 End: 18484441
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291123330
  EHDDRKYASCAVVGNSGILLASEHGGLIDSHELVVRLNNAPAGKEGTALARRVGARTGLAFLNSNVLSRCAGAGCCRERYGGGAMAVPVLTYMCSGAHFV
  EHTACSSSSSNASSLSAPVIVTDPRLDALCARVAKYYSLRRFAREKGRPAEEWAAVHEEGMFHYSSGLQAVVAAAGVCERVSVFGFGKAAGVRHHYHTLQ
  KGELDLHDYEAEYEFYRDLQEA
Full Sequence
Protein Sequence     Length: 356     Download
MAALILLVAF RCSLHHHSVP GGRQSRADGA GHDDAALMEL AAIDTAATSV LEAAKKMLEG    60
NLARAPEEHR EVAVRGLRQW IGQQQRFDPG VMSELVSLVK RPIDRYYGRD GEHDDRKYAS    120
CAVVGNSGIL LASEHGGLID SHELVVRLNN APAGKEGTAL ARRVGARTGL AFLNSNVLSR    180
CAGAGCCRER YGGGAMAVPV LTYMCSGAHF VEHTACSSSS SNASSLSAPV IVTDPRLDAL    240
CARVAKYYSL RRFAREKGRP AEEWAAVHEE GMFHYSSGLQ AVVAAAGVCE RVSVFGFGKA    300
AGVRHHYHTL QKGELDLHDY EAEYEFYRDL QEARPEGIPF LRDSGFTLPP VVFYR*        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_297.0e-627633061+
pfam00777Glyco_transf_293.0e-1211618066+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAH67271.10135517384OSIGBa0145C12.8 [Oryza sativa (indica cultivar-group)]
EMBLCAN64919.103435452388hypothetical protein [Vitis vinifera]
RefSeqNP_001053259.10135517384Os04g0506800 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002277132.103435452388PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002446759.101035524381hypothetical protein SORBIDRAFT_06g021930 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000004121307100258A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3)
PDB2wnb_A0.0000004121307100258A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.0000004121307100258A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Signal Peptide
Cleavage Site
15
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL8568242131453560
FL856825238472800
EE17750727712640
EC8767412191163310
EC87674123841064.7
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00099.1
Arabidopsis lyrata470889
Arabidopsis thalianaAT1G08280.1
Brachypodium distachyonBradi4g42490.1Bradi2g55530.1
Brassica rapaBra018639
Carica papayaevm.model.supercontig_32.97
Capsella rubellaCarubv10009362m
Citrus clementinaCiclev10028611m
Citrus sinensisorange1.1g045324m
Cucumis sativusCucsa.385070.1
Eucalyptus grandisEucgr.B03871.2Eucgr.B03871.1Eucgr.B03872.1
Fragaria vescamrna22044.1-v1.0-hybrid
Glycine maxGlyma12g09360.1Glyma12g09380.1Glyma12g09370.1Glyma11g19080.1
Gossypium raimondiiGorai.004G009500.1Gorai.009G086400.1Gorai.001G121600.1Gorai.001G121600.2
Linum usitatissimumLus10043382Lus10019538
Malus domesticaMDP0000819808MDP0000297352MDP0000232578
Manihot esculentacassava4.1_025383mcassava4.1_029496m
Medicago truncatulaMedtr4g053520.1
Mimulus guttatusmgv1a007914m
Oryza sativaLOC_Os01g63970.1LOC_Os04g42760.1LOC_Os12g05550.1
Panicum virgatumPavirv00000013mPavirv00026461mPavirv00017508mPavirv00017918mPavirv00063645m
Pavirv00039153mPavirv00003354mPavirv00055978m
Physcomitrella patensPp1s66_22V6.1Pp1s258_38V6.1Pp1s269_58V6.1
Phaseolus vulgarisPhvul.011G093000.1
Picea abiesMA_473578g0010MA_5257g0010MA_76451g0010MA_10437278g0030MA_10426176g0010
MA_180941g0010
Populus trichocarpaPotri.009G144000.1Potri.004G184200.1
Prunus persicappa006961m
Ricinus communis30055.m001540
Setaria italicaSi010021mSi001764mSi028299mSi012629mSi027686m
Selaginella moellendorffii133452589
Sorghum bicolorSb05g003170.1Sb05g003150.1Sb06g021930.1Sb05g003160.1Sb03g040480.1
Thellungiella halophilaThhalv10007826m
Vitis viniferaGSVIVT01036150001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny