y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g17390.1
FamilyGT22
Protein PropertiesLength: 499 Molecular Weight: 56469.6 Isoelectric Point: 9.1844
ChromosomeChromosome/Scaffold: 5 Start: 20666468 End: 20673435
Descriptionhomolog of asparagine-linked glycosylation 12
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22243930
  GSIAAFYAVMVPYTKVEESFNVQAIHDILYHNHHIDKYDHLEFPGVVPRTFIGALVISLLSSPAILMMRIFHVPKVYSLLAVRLMLGCVTLTTLRLFRVE
  IKRKYGRHVEAFFVILTAIQFHVLFYSTRPLPNILALAFVNLAYSFWFKGNFLCTLQALIVAAVVFRCDMVLLLGTIGIALLLSRSFSLLEAVKCCISTV
  LVCIGFTVLVDSIMWQRILWPEFEVFWFNSVLNRSSEWGTHSIHWYFTSALPRSMLVAYPLCLVGALLDRRIVPYVLPVALFVVLYSKLPHKELRFIIAS
  IPMFNVSASLAAGRIYNNRKKSGWNFLYVLMLGAFLVSLGYSAVTFMASYSNYPGGHALKALHEADSSVK
Full Sequence
Protein Sequence     Length: 499     Download
MAPPPPPTPA ARILRDYGWD LLLGSIAAFY AVMVPYTKVE ESFNVQAIHD ILYHNHHIDK    60
YDHLEFPGVV PRTFIGALVI SLLSSPAILM MRIFHVPKVY SLLAVRLMLG CVTLTTLRLF    120
RVEIKRKYGR HVEAFFVILT AIQFHVLFYS TRPLPNILAL AFVNLAYSFW FKGNFLCTLQ    180
ALIVAAVVFR CDMVLLLGTI GIALLLSRSF SLLEAVKCCI STVLVCIGFT VLVDSIMWQR    240
ILWPEFEVFW FNSVLNRSSE WGTHSIHWYF TSALPRSMLV AYPLCLVGAL LDRRIVPYVL    300
PVALFVVLYS KLPHKELRFI IASIPMFNVS ASLAAGRIYN NRKKSGWNFL YVLMLGAFLV    360
SLGYSAVTFM ASYSNYPGGH ALKALHEADS SVKEKTVHID AFTAMSGVSR FCENENPWRY    420
SKEEDISIEE YQRRNFTYLL NEHRYISGYK CLFAVEGFSR AKIQPGIPPI SLVKVPKVFA    480
HGNTRDPDIL SLDWPGCP*                                                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028163.0e-6227326102+
pfam03901Glyco_transf_225.0e-3335402388+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001053463.1044983497Os04g0544900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001077446.1054972493transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001077448.1054972497transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001148825.1054982498dolichyl-P-Man Man [Zea mays]
RefSeqXP_002448266.102049822500hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5466EC-2.4.1.258Dol-P-Man:Man5GlcNAc2-PP-Dol α-1,3-mannosyltransferase
Transmembrane Domains
StartEnd
7496
103122
132149
154171
186208
220242
266288
295312
317339
346368
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CD4400542691524200
FF339954267122780
ES4360903011534510
EL435541333403720
EB6399862671734390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.1AT1G02145.2AT1G02145.4AT1G02145.3
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Fragaria vescamrna05309.1-v1.0-hybrid
Glycine maxGlyma07g13150.1Glyma03g25680.2Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.2Gorai.004G166900.4Gorai.004G166900.1Gorai.004G166900.3
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.2Phvul.010G045600.4Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny