y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g18010.1
FamilyGT1
Protein PropertiesLength: 467 Molecular Weight: 51013.9 Isoelectric Point: 6.8208
ChromosomeChromosome/Scaffold: 5 Start: 21120811 End: 21122365
DescriptionUDP-glucosyl transferase 73B5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1214451.4e-37
  LHLSLHLASRGLPVHYAAPAPHVRQARSRVHGWDPQALASVHFHDLDLPAYEQPPPDPTVPTSFPSHLMPMLDAFVSHAGAPLARLLARLSARHRRVVVV
  YDRLSSFAAVEAAGLPNGEAFCVQCVSVSYNVAFKDAAHRLLRGHGLEFHPVDACVSKEFEEYIAKTWQDGQGTTVRGLVVNTCRALEGEFHRREAHSPE
  YAGQRIFAVGPLNPLLLDATTTTTTTPGLPRHECLDWLDRQPPASVLYVSFGTTSSLLAEQVAEIGAALRDSKHRFIWVLRDADRASHDEEATESRHARA
  LSSLPGFARQTQGTGLVITGWAPQLEILAHGSTAAFMSHCGWNSTVESLSHGKPILAWPMHSDQPWDAELLCKYLKAGLLVRPLEKRDTVVPAEAIREVI
  EKALVSDEGLQTRERAKALGESIRA
Full Sequence
Protein Sequence     Length: 467     Download
MESVAVVAVP FPAQGHLNQL LHLSLHLASR GLPVHYAAPA PHVRQARSRV HGWDPQALAS    60
VHFHDLDLPA YEQPPPDPTV PTSFPSHLMP MLDAFVSHAG APLARLLARL SARHRRVVVV    120
YDRLSSFAAV EAAGLPNGEA FCVQCVSVSY NVAFKDAAHR LLRGHGLEFH PVDACVSKEF    180
EEYIAKTWQD GQGTTVRGLV VNTCRALEGE FHRREAHSPE YAGQRIFAVG PLNPLLLDAT    240
TTTTTTPGLP RHECLDWLDR QPPASVLYVS FGTTSSLLAE QVAEIGAALR DSKHRFIWVL    300
RDADRASHDE EATESRHARA LSSLPGFARQ TQGTGLVITG WAPQLEILAH GSTAAFMSHC    360
GWNSTVESLS HGKPILAWPM HSDQPWDAEL LCKYLKAGLL VRPLEKRDTV VPAEAIREVI    420
EKALVSDEGL QTRERAKALG ESIRASVADG GSSHKDLEEF ITYIAR*                  480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028634.0e-42198466272+
PLN02554PLN025543.0e-42197461281+
PLN00164PLN001643.0e-48197459270+
PLN02448PLN024486.0e-49226465244+
PLN03007PLN030071.0e-49198461277+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL75980.1014661462AF466203_9 putative cis-zeatin O-glucosyltransferase [Zea mays]
EMBLCAH67400.1014666463OSIGBa0137D06.1 [Oryza sativa (indica cultivar-group)]
GenBankEAY95124.1014666463hypothetical protein OsI_16941 [Oryza sativa Indica Group]
RefSeqNP_001053526.1014666463Os04g0556500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105017.1014666467cis-zeatin O-glucosyltransferase1 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A9.80909e-45198457209460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2vch_A9.80909e-45198457209460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2vce_A9.80909e-45198457209460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A4.00001e-40646111474A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B3e-34645312450A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF3400092492194670
FE6155192522164670
BQ9028172741944670
BQ9027682741944670
EC8921642212474670
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)