y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g18030.1
FamilyGT1
Protein PropertiesLength: 467 Molecular Weight: 50653.9 Isoelectric Point: 6.6934
ChromosomeChromosome/Scaffold: 5 Start: 21132090 End: 21133663
DescriptionUDP-glycosyltransferase 73B4
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11494495.5e-40
  AFGLHCLAVSTLVGKMDADHRLMRENGLTFAPIENCATKEFVEYANRARPLAQISPGVGILTNTCRALEGDFIDVVAEDLAADGKKVFAIGPLNPLLHAS
  ASKQRPHECLDWLDKQPPASVLYVSFGTTSSLRAEQIEELAAALRGSKQRFIWVLRDADRGDIFAEAGESRHEKLLSEFTKQTQGTGLVITGWAPQLEIL
  AHGATAAFMSHCGWNSTMESLSHGKPILAWPMHCDQPWDAELVCNYLKAGILVRPWEKHSEVITAKAIQEVIEEAMLSDKGMAVQQRARVLGDAVRAAVA
  P
Full Sequence
Protein Sequence     Length: 467     Download
MVRGNNQPLD PVAVVAVPFP AQGHLNQLLH LSLLLASRGG LQVHYAAPAQ HVRQARARVH    60
GWDEDALLSI RFHELGISSY VSPPPNPTAD SPFPSHLMPL FEAFTADARG PLAALLGKLS    120
ASCRRVVVVH DRINAFAGEE AARLPNGEAF GLHCLAVSTL VGKMDADHRL MRENGLTFAP    180
IENCATKEFV EYANRARPLA QISPGVGILT NTCRALEGDF IDVVAEDLAA DGKKVFAIGP    240
LNPLLHASAS KQRPHECLDW LDKQPPASVL YVSFGTTSSL RAEQIEELAA ALRGSKQRFI    300
WVLRDADRGD IFAEAGESRH EKLLSEFTKQ TQGTGLVITG WAPQLEILAH GATAAFMSHC    360
GWNSTMESLS HGKPILAWPM HCDQPWDAEL VCNYLKAGIL VRPWEKHSEV ITAKAIQEVI    420
EEAMLSDKGM AVQQRARVLG DAVRAAVAPG GSSRKDLDDL IAYMTR*                  480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02555PLN025553.0e-44208461263+
PLN02863PLN028636.0e-46207466268+
PLN02448PLN024481.0e-47235465239+
PLN03007PLN030073.0e-50207461268+
PLN00164PLN001643.0e-50207453260+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACD03254.101246611465UDP-glycosyltransferase UGT93B9 [Avena strigosa]
GenBankACD03259.101246513472UDP-glycosyltransferase UGT93B8 [Avena strigosa]
EMBLCAH66756.1034664464OSIGBa0158F05.5 [Oryza sativa (indica cultivar-group)]
GenBankEAY95122.1094661473hypothetical protein OsI_16939 [Oryza sativa Indica Group]
RefSeqNP_001053574.1034664464Os04g0565400 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A1.4013e-451446111474A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A3.9937e-43207457209460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A3.9937e-43207457209460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A3.9937e-43207457209460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B1e-358146577462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BQ9028172771934670
BQ9027682771934670
EG3969312532154650
CJ8502602182504670
FF3400092382334670
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)