y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g18220.1
FamilyGH29
Protein PropertiesLength: 514 Molecular Weight: 56674.3 Isoelectric Point: 4.9749
ChromosomeChromosome/Scaffold: 5 Start: 21268929 End: 21272154
Descriptionalpha-L-fucosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH29273360
  TPPPLPVLPVPSYAQLQWQLAEMALFLHFGPNTFTDSEWGSGHADPSVFAPSALDARQWARVASEGGFGRVVLTAKHHDGFCLWPSALTDYSVAASPWRE
  GAGDVVGELSAAARAEGIGLGLYLSPWDRHEPVYGDTVAYNEHYMGQMTELLARYGDVEEVWLDGAKGDDKHMDYMFDAWFALIHQLQRRVVIFSDAGPD
  TRWVGDEAGVAGRTCWSPFNKSVVTIGHIIPEYSRNGDPFGQDWVPAECDVSIRPGWFWHASEKPKSAIVLLDIYYKSVGRNCLLILNIPPNSSGLISDE
  DMQVLKEFTE
Full Sequence
Protein Sequence     Length: 514     Download
MSVLLVVLLV HLHLLLCAHG AAADAATPPP LPVLPVPSYA QLQWQLAEMA LFLHFGPNTF    60
TDSEWGSGHA DPSVFAPSAL DARQWARVAS EGGFGRVVLT AKHHDGFCLW PSALTDYSVA    120
ASPWREGAGD VVGELSAAAR AEGIGLGLYL SPWDRHEPVY GDTVAYNEHY MGQMTELLAR    180
YGDVEEVWLD GAKGDDKHMD YMFDAWFALI HQLQRRVVIF SDAGPDTRWV GDEAGVAGRT    240
CWSPFNKSVV TIGHIIPEYS RNGDPFGQDW VPAECDVSIR PGWFWHASEK PKSAIVLLDI    300
YYKSVGRNCL LILNIPPNSS GLISDEDMQV LKEFTEIRQT IFSQNFAANA TVMASSVRGG    360
LNNLQFAPSS ALQDSIYSYW APQEGQTSWE MLFDLGRSTS FNLLQLQEPI QLGQRVIRFH    420
VDILVGELWE TILEGTTIGY KRLLQFPAVQ ARYLKLSVDS ARADPLIAFF GVFMDPFSVI    480
YSLDHGKPPR TNSSEVIMLK TDHAAGNKST ATV*                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01120Alpha_L_fucos2.0e-3244336326+
smart00812Alpha_L_fucos7.0e-3475336288+
COG3669COG36692.0e-6441473447+
Gene Ontology
GO TermDescription
GO:0004560alpha-L-fucosidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG47369.101750915509alpha-L-fucosidase 1 precursor [Zea mays]
EMBLCAH68057.103851341517B0103C08-B0602B01.14 [Oryza sativa (indica cultivar-group)]
RefSeqNP_001053546.103851341517Os04g0560400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131532.101750915509hypothetical protein LOC100192871 [Zea mays]
RefSeqXP_002448322.101951317513hypothetical protein SORBIDRAFT_06g025200 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ues_B03746819471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3ues_A03746819471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3mo4_B03746821473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3mo4_A03746821473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3uet_B03746819471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis D172aE217A MUTANT COMPLEXED WITH LACTO-N- Fucopentaose Ii
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8461173361735080
GT0409033421735140
JG9115193031995000
GT0363922912245140
JG9443102751684420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00507.1Aquca_062_00017.1
Arabidopsis lyrata481700
Arabidopsis thalianaAT2G28100.1
Brachypodium distachyonBradi4g35500.1
Brassica rapaBra034388
Carica papayaevm.model.supercontig_65.36evm.model.supercontig_3.250
Capsella rubellaCarubv10023050m
Citrus clementinaCiclev10028463m.194.266Ciclev10004832mCiclev10028210mCiclev10028463m.194.266Ciclev10028463m.51.191
Ciclev10028463m.51.191
Citrus sinensisorange1.1g011170morange1.1g047217m
Cucumis sativusCucsa.385790.1Cucsa.193300.1
Eucalyptus grandisEucgr.J00379.2Eucgr.J00379.1Eucgr.J00367.1Eucgr.A02862.1Eucgr.A02861.1
Fragaria vescamrna13375.1-v1.0-hybridmrna28904.1-v1.0-hybridmrna13376.1-v1.0-hybrid
Glycine maxGlyma12g30151.1Glyma13g39750.2Glyma10g38670.2Glyma20g29080.1Glyma10g38670.1
Gossypium raimondiiGorai.004G231200.1Gorai.008G282700.1
Linum usitatissimumLus10016140Lus10027390Lus10031681Lus10021427
Malus domesticaMDP0000166406MDP0000271120MDP0000917175MDP0000295518
Manihot esculentacassava4.1_032976mcassava4.1_006636mcassava4.1_007875mcassava4.1_021316m
Medicago truncatulaMedtr1g102230.1Medtr2g095700.1
Mimulus guttatusmgv1a004219mmgv1a005268m
Oryza sativaLOC_Os09g34920.1LOC_Os04g47280.1
Panicum virgatumPavirv00068426mPavirv00016802mPavirv00061161m
Physcomitrella patensPp1s55_131V6.2Pp1s55_131V6.1
Phaseolus vulgarisPhvul.007G063900.1Phvul.005G131200.1
Picea abiesMA_16736g0010MA_171759g0010MA_8122188g0010
Populus trichocarpaPotri.015G133500.1Potri.009G006900.1Potri.012G131400.1
Prunus persicappa023537mppa005337m
Ricinus communis30147.m01415529589.m001240
Setaria italicaSi009874mSi029623m
Selaginella moellendorffii103164236749.37.121236749.37.121415432412246
236951112167158775103375431829
236749.167.333236749.167.333431838103154
Sorghum bicolorSb06g025200.1Sb02g030220.1
Thellungiella halophilaThhalv10016493mThhalv10016468m
Vitis viniferaGSVIVT01018468001.39.381GSVIVT01018468001.39.381GSVIVT01018468001.542.842GSVIVT01018468001.542.842GSVIVT01031495001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)