y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g20997.1
FamilyGT47
Protein PropertiesLength: 348 Molecular Weight: 40282.6 Isoelectric Point: 9.6916
ChromosomeChromosome/Scaffold: 5 Start: 23768773 End: 23771441
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47122700
  VKIHQLLLKSRFRTLDKDEAHLFFVPSYVKCVRMTGALTDKEINQTYVKVLSQMPYFRRSGGRDHIFVFPSGAGAHLFRSWATFLNRSIILTPEGDRTDK
  RGISAFNTWKDIIIPGNVDDSMVKPDARAVQPIPLTKRKYLANFLGRAQGKAGRLKLVELAKQYPDKLESPELKLSGPDKLGRIDYFKHLRNAKFCLAPR
  GESSWTLRFYESFFVECVPVILSDEVELPFQNMIDYTEISIKWPSSKISPELFEYLESI
Full Sequence
Protein Sequence     Length: 348     Download
MRGPHHPPCT RVKIHQLLLK SRFRTLDKDE AHLFFVPSYV KCVRMTGALT DKEINQTYVK    60
VLSQMPYFRR SGGRDHIFVF PSGAGAHLFR SWATFLNRSI ILTPEGDRTD KRGISAFNTW    120
KDIIIPGNVD DSMVKPDARA VQPIPLTKRK YLANFLGRAQ GKAGRLKLVE LAKQYPDKLE    180
SPELKLSGPD KLGRIDYFKH LRNAKFCLAP RGESSWTLRF YESFFVECVP VILSDEVELP    240
FQNMIDYTEI SIKWPSSKIS PELFEYLESI PEERIEEMIA RGREVRCLWV YAPDLEPCSA    300
MAAILWELQR KVRRFHQSAQ TFWLHNRSTV NRDLVEFHQW TTTVPLP*                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin2.0e-4112249250+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY93033.101034791429hypothetical protein OsI_14833 [Oryza sativa Indica Group]
RefSeqNP_001131485.101034789426hypothetical protein LOC100192822 [Zea mays]
RefSeqXP_002307477.1010347123460predicted protein [Populus trichocarpa]
RefSeqXP_002458782.101034789426hypothetical protein SORBIDRAFT_03g040220 [Sorghum bicolor]
RefSeqXP_002526175.1010347116453catalytic, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX668832291343240
FE707914279142920
JG790881262523100
EH692645270513200
FE707913274753480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00344.3Aquca_014_00344.1Aquca_014_00344.2
Arabidopsis lyrata472383
Arabidopsis thalianaAT1G21480.2AT1G21480.1
Brassica rapaBra016420Bra017918
Carica papayaevm.model.supercontig_49.73
Capsella rubellaCarubv10009077m
Citrus clementinaCiclev10001673mCiclev10002072mCiclev10001104mCiclev10001922m
Cucumis sativusCucsa.077120.2Cucsa.077120.1
Eucalyptus grandisEucgr.E02380.2Eucgr.E02380.1
Fragaria vescamrna00939.1-v1.0-hybrid
Glycine maxGlyma14g38290.1
Gossypium raimondiiGorai.005G082700.1Gorai.005G082700.6Gorai.005G082700.3Gorai.005G082700.2Gorai.005G082700.4
Gorai.005G082700.5
Linum usitatissimumLus10028632Lus10018930
Malus domesticaMDP0000251576MDP0000259719
Manihot esculentacassava4.1_011268mcassava4.1_012629m
Mimulus guttatusmgv1a006022m
Panicum virgatumPavirv00023264mPavirv00031056m
Physcomitrella patensPp1s48_252V6.1
Phaseolus vulgarisPhvul.001G063800.1
Populus trichocarpaPotri.002G072300.1Potri.005G187400.3Potri.005G187400.2Potri.005G187400.1
Prunus persicappa005428m
Ricinus communis27985.m000889
Setaria italicaSi002210mSi002276mSi001530m
Selaginella moellendorffii104774
Sorghum bicolorSb03g040220.1
Thellungiella halophilaThhalv10007584m
Vitis viniferaGSVIVT01010019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny