y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g24207.1
FamilyGH89
Protein PropertiesLength: 830 Molecular Weight: 94405.3 Isoelectric Point: 5.2537
ChromosomeChromosome/Scaffold: 5 Start: 25919230 End: 25929170
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH891008050
  PEILILGVSGVEISAGLHWYLKHYCAAHISWAKTGGAQLSSVPHPGSLPHVPAGGILIRRPVDWSYYQNAVTSSYSFAWWDWERWENEIDWMALQGINLP
  LAFTGQEAIWQKVFQRYNISKSNLDDFFGGPAFLAWSRMANMHGWGGPLPQTWLDDQLTLQKKILSRMYAFGMSPVLPAFSGSIPAALKSKFPSAKVTHL
  GNWFTVDSNPRWCCTYLLDASDPLFVEIGKLFIEEQIREYGRTSHVYNCDTFDENTPPLSDPNYISSLGAATFRGMQSGDDDAIWLMQGWLFTYDPFWEP
  PQMKALLHSVPVGRMIVLDLYAEVKPVWINSDQFYGVPYIWCMLHNFAADFEMYGVLDAVASGPIDARLSENSTMVGVGMSMEGIEQNPIVYDLMSEMVF
  HHRQVDLQVWVETYPTRRYGKSIVELQDAWRILHQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGLHTSASKMFSTMSAKSYLVKDESNDAYEQPHLW
  YDTNVVIRALQLFLQYGDEVSDSSTFRYDLVDLTRQALAKYANQIFAKIIQSYKSNNMNQVTTLSECFLDLVNDLDMLLASHEGFLLGPWLESAKGLARD
  QEQEIQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLGDYYGPRAAIYFKYLILSLEKKEPFALEEWRREWISLTNNWQSDRKVFATAATGDALNI
  ARSLYM
Full Sequence
Protein Sequence     Length: 830     Download
MLPSSPAPRF LLLVAVIACA ASVTRCSGRR FAQLDRLREL HQRERRPPAE QVYAAEGLLA    60
RLLPSHSTSF EFRVISTEQC GGKACFIINN HPLFDGEGTP EILILGVSGV EISAGLHWYL    120
KHYCAAHISW AKTGGAQLSS VPHPGSLPHV PAGGILIRRP VDWSYYQNAV TSSYSFAWWD    180
WERWENEIDW MALQGINLPL AFTGQEAIWQ KVFQRYNISK SNLDDFFGGP AFLAWSRMAN    240
MHGWGGPLPQ TWLDDQLTLQ KKILSRMYAF GMSPVLPAFS GSIPAALKSK FPSAKVTHLG    300
NWFTVDSNPR WCCTYLLDAS DPLFVEIGKL FIEEQIREYG RTSHVYNCDT FDENTPPLSD    360
PNYISSLGAA TFRGMQSGDD DAIWLMQGWL FTYDPFWEPP QMKALLHSVP VGRMIVLDLY    420
AEVKPVWINS DQFYGVPYIW CMLHNFAADF EMYGVLDAVA SGPIDARLSE NSTMVGVGMS    480
MEGIEQNPIV YDLMSEMVFH HRQVDLQVWV ETYPTRRYGK SIVELQDAWR ILHQTLYNCT    540
DGKNDKNRDV IVAFPDVEPF VIQTPGLHTS ASKMFSTMSA KSYLVKDESN DAYEQPHLWY    600
DTNVVIRALQ LFLQYGDEVS DSSTFRYDLV DLTRQALAKY ANQIFAKIIQ SYKSNNMNQV    660
TTLSECFLDL VNDLDMLLAS HEGFLLGPWL ESAKGLARDQ EQEIQYEWNA RTQITMWFDN    720
TETKASLLRD YANKYWSGLL GDYYGPRAAI YFKYLILSLE KKEPFALEEW RREWISLTNN    780
WQSDRKVFAT AATGDALNIA RSLYMKYLRN ADSLQLEDMD GSFGKSTSL*               840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12971NAGLU_N7.0e-215114898+
pfam12972NAGLU_C6.0e-98509807299+
pfam05089NAGLU0165503339+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE04506.201981918818OSJNBb0059K02.16 [Oryza sativa (japonica cultivar-group)]
GenBankEEC78143.101981918818hypothetical protein OsI_17702 [Oryza sativa Indica Group]
GenBankEEE61812.10298193281118hypothetical protein OsJ_16433 [Oryza sativa Japonica Group]
RefSeqXP_002280399.103481631813PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511461.1068136805alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A070828192891A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB2vcb_A070828192891A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB2vca_A070828192891A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB2vc9_A070828192891A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A070828215914A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0394803494427880
HO7831284243517740
GT0494373085168230
GT0440063085168230
GO8726882743296020
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780
Gorai.001G078400.1.96.430Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832
Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)