y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g24280.1
FamilyGT1
Protein PropertiesLength: 535 Molecular Weight: 57174.6 Isoelectric Point: 6.984
ChromosomeChromosome/Scaffold: 5 Start: 25982652 End: 25984858
DescriptionUDP-glucosyl transferase 89B1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11275125.3e-31
  TLPFPTHNSLPPGVESTKNCPPSFFPAFIHAFAALHHPILSWANSQQQQHDPVVAIVSDFFCGWTQPLAAELGVPRLVFSPSGVLGAAVPHSLLRRLVRR
  PPDDADDGFKVAFPGIPGEPAYQWREISMMYRMYTEGRLEPQVGEAVRRNFLWNLESWGFVSNTLRALEGRYLEAPLEDLGFRRVWAVGPLAPEKDVAGD
  RGGEAAVSAGDLGAWLDGFPEGSVVYVCFGSQTVLNQAVAAALAEALELSAVPFVWVVGAGAGDEVVPQGFEALVSRGRVVRGWAPQVAVLRHAAVGWFM
  THCGWNSVLEAVAAGVPMLAWPMTADQFVNARLLVDEARVAVRACAGGVGVAPDARELAAMLAGAVGEGGGGARARARELAKEAAS
Full Sequence
Protein Sequence     Length: 535     Download
MKRLMKTGIH RDQPAPAEKT TEPDVALYMP SCSRGASEAK VATHACCQIH LQQQQQQLPP    60
RSIFRPGPGP HVLVVPFSAQ GHALPLLDFA SQLAARGLRL TVVTTPANLP LLSPLLAAYP    120
SSIRPLTLPF PTHNSLPPGV ESTKNCPPSF FPAFIHAFAA LHHPILSWAN SQQQQHDPVV    180
AIVSDFFCGW TQPLAAELGV PRLVFSPSGV LGAAVPHSLL RRLVRRPPDD ADDGFKVAFP    240
GIPGEPAYQW REISMMYRMY TEGRLEPQVG EAVRRNFLWN LESWGFVSNT LRALEGRYLE    300
APLEDLGFRR VWAVGPLAPE KDVAGDRGGE AAVSAGDLGA WLDGFPEGSV VYVCFGSQTV    360
LNQAVAAALA EALELSAVPF VWVVGAGAGD EVVPQGFEAL VSRGRVVRGW APQVAVLRHA    420
AVGWFMTHCG WNSVLEAVAA GVPMLAWPMT ADQFVNARLL VDEARVAVRA CAGGVGVAPD    480
ARELAAMLAG AVGEGGGGAR ARARELAKEA ASATMEGGSS RDDLDRLVRE IRKL*         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02670PLN026708.0e-3371460402+
PLN03004PLN030048.0e-37282463191+
PLN03007PLN030072.0e-5071460414+
PLN02534PLN025341.0e-5270462411+
PLN02863PLN028638.0e-12662463410+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22719.106853414484UDP-glycosyltransferase [Brachypodium distachyon]
EMBLCAJ86181.101455342377H0212B02.10 [Oryza sativa (indica cultivar-group)]
GenBankEEC78140.101455342365hypothetical protein OsI_17697 [Oryza sativa Indica Group]
RefSeqNP_001054090.10665344469Os04g0650400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002448651.10665347480hypothetical protein SORBIDRAFT_06g030820 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A3e-39705319477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B2e-376353113461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A2e-376353113461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acv_B2e-376353113461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A2e-376353113461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
curcumin glucoside biosynthesisRXN-7062EC-2.4.1UDP-glucose:curcumin glucosyltransferase
curcumin glucoside biosynthesisRXN-7063EC-2.4.1UDP-glucose:curcumin monoglucoside glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC888987291663540
EE018658280683450
EE033998268663310
DV031361255663180
EE037000251663140
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi5g10710.1Bradi3g38930.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04524.1-v1.0-hybridmrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1Glyma06g22820.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G185000.1Gorai.012G184900.1Gorai.008G174800.1
Gorai.012G185100.1Gorai.003G103500.1Gorai.006G228500.1Gorai.006G228600.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563MDP0000234849
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17250.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)