y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g24850.2
FamilyGT75
Protein PropertiesLength: 349 Molecular Weight: 38898.8 Isoelectric Point: 6.8654
ChromosomeChromosome/Scaffold: 5 Start: 26374746 End: 26375792
DescriptionAlpha-1,4-glucan-protein synthase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT7563440
  QDSEVDIVIAALQPNLTSFFEAWQPFFSRFHIIVVKDPDMAADLKIPSGFDVKVYTKSDIEGLLGATSINFSGHSCRYFGYLVSRKKYVISIDDNCLPAK
  DTAGMTVDAVTQHMINLKTPATPFFFNTLYDPYRKGADFVRGYPFSLREGVECMLSSGLWLHNADYDPMTHVVKRNQRNTNYVDAVMTVPLGAMMPVSGI
  NVAFNREVLGPVMFPGLRIRKEGKHRWDTLEDIWNGLCAKVVCDSLGYGVKTGLPYVMRSDAEAGKALESLKDWEGVKVMDNVLPFFQSLKLSRTAVTVD
  DCVKELASIVREKLAPKNPIFAKAADAMEEWTKLWKSHG
Full Sequence
Protein Sequence     Length: 349     Download
MSLEVQDSEV DIVIAALQPN LTSFFEAWQP FFSRFHIIVV KDPDMAADLK IPSGFDVKVY    60
TKSDIEGLLG ATSINFSGHS CRYFGYLVSR KKYVISIDDN CLPAKDTAGM TVDAVTQHMI    120
NLKTPATPFF FNTLYDPYRK GADFVRGYPF SLREGVECML SSGLWLHNAD YDPMTHVVKR    180
NQRNTNYVDA VMTVPLGAMM PVSGINVAFN REVLGPVMFP GLRIRKEGKH RWDTLEDIWN    240
GLCAKVVCDS LGYGVKTGLP YVMRSDAEAG KALESLKDWE GVKVMDNVLP FFQSLKLSRT    300
AVTVDDCVKE LASIVREKLA PKNPIFAKAA DAMEEWTKLW KSHGAQNA*                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03214RGP01348350+
PLN03180PLN0318001347350+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0007047: GO:0044234
GO:0008466glycogenin glucosyltransferase activity
GO:0016758transferase activity, transferring hexosyl groups
GO:0030054cell junction
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF86668.1013481349unknown [Zea mays]
EMBLCAA77236.1013481348amylogenin [Triticum aestivum]
RefSeqNP_001054143.1013481347Os04g0660400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151577.1013481349alpha-1,4-glucan-protein synthase [Zea mays]
RefSeqXP_002447267.1013481348hypothetical protein SORBIDRAFT_06g031590 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT040275289613490
CK20872533923340
FL729234265212850
CB61991027152750
CK208725522883390.00000006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00413.1Aquca_002_00849.1Aquca_011_00106.2Aquca_011_00106.1Aquca_002_00849.2
Aquca_058_00152.1Aquca_002_00849.3Aquca_002_00849.4
Arabidopsis lyrata477458488410317692918103333145
488506
Arabidopsis thalianaAT3G02230.1AT3G08900.1AT5G15650.1AT5G50750.1AT5G16510.2
AT5G16510.1
Brachypodium distachyonBradi1g21990.1Bradi1g15050.1Bradi2g50660.1
Brassica rapaBra001037Bra021473Bra039165Bra008683Bra001338
Bra006315Bra029728Bra000628Bra008616Bra023530.143.331
Bra023530.143.331Bra023530.18.141Bra023530.18.141Bra023571Bra006359
Carica papayaevm.model.supercontig_1095.2evm.model.supercontig_1.156evm.model.supercontig_14.210evm.model.supercontig_123.13
Capsella rubellaCarubv10014051mCarubv10015472mCarubv10001241mCarubv10027526mCarubv10002568m
Chlamydomonas reinhardtiiCre13.g565800.t1.2
Citrus clementinaCiclev10020723mCiclev10031914mCiclev10011996mCiclev10033661mCiclev10013540m
Citrus sinensisorange1.1g018080morange1.1g017862morange1.1g024882morange1.1g025304morange1.1g045145m
orange1.1g048449morange1.1g039651morange1.1g038078m
Cucumis sativusCucsa.113400.1Cucsa.327910.1Cucsa.198650.1Cucsa.174470.1Cucsa.285070.2
Cucsa.285070.1
Eucalyptus grandisEucgr.K02544.2Eucgr.K02544.1Eucgr.I02055.1Eucgr.B00630.1Eucgr.B01380.1
Fragaria vescamrna26116.1-v1.0-hybridmrna06291.1-v1.0-hybridmrna04238.1-v1.0-hybridmrna16775.1-v1.0-hybrid
Glycine maxGlyma02g13330.1Glyma01g07930.1Glyma06g22440.1Glyma13g06690.1Glyma04g32080.1
Glyma19g04240.1Glyma18g50780.1Glyma08g27590.1Glyma08g27590.2Glyma04g32080.2
Glyma18g47520.3Glyma18g47520.2Glyma09g38800.5Glyma09g38800.4
Gossypium raimondiiGorai.001G076300.1Gorai.001G196500.1Gorai.008G200200.1Gorai.007G039800.2Gorai.001G090200.1
Gorai.007G039800.1Gorai.007G176700.1Gorai.001G208000.1Gorai.013G095500.1Gorai.008G200200.2
Gorai.008G200200.3Gorai.007G039800.3Gorai.013G095500.3Gorai.001G196500.2Gorai.013G095500.2
Gorai.004G260800.1Gorai.013G180500.3Gorai.013G180500.2Gorai.013G180500.1Gorai.013G095500.4
Gorai.007G039800.5Gorai.007G039800.4Gorai.008G200200.4
Linum usitatissimumLus10000646Lus10036970Lus10005076Lus10017868Lus10026676
Lus10004640Lus10022443Lus10034376Lus10016749Lus10034665
Lus10009555Lus10020379Lus10034664Lus10033057
Malus domesticaMDP0000232047MDP0000174584MDP0000394728MDP0000286141MDP0000291731
MDP0000778464MDP0000146639.162.400MDP0000146639.162.400MDP0000631513MDP0000265452
MDP0000156652MDP0000461829MDP0000156837MDP0000204345MDP0000236647
MDP0000844514MDP0000146639.13.109MDP0000146639.13.109MDP0000811808MDP0000595769
MDP0000532585MDP0000512932MDP0000133673
Manihot esculentacassava4.1_010056mcassava4.1_010414mcassava4.1_010408mcassava4.1_010334mcassava4.1_010183m
cassava4.1_010136mcassava4.1_026327mcassava4.1_024143mcassava4.1_010799m
Medicago truncatulaMedtr5g046030.1Medtr7g079490.2Medtr7g079490.1
Mimulus guttatusmgv1a008980mmgv1a008906mmgv1a008625mmgv1a009275mmgv1a009196m
mgv11b024632m
Oryza sativaLOC_Os03g40270.1LOC_Os07g41360.1LOC_Os04g56520.2LOC_Os04g56520.1
Panicum virgatumPavirv00056327mPavirv00011249mPavirv00032019mPavirv00056328mPavirv00013211m
Pavirv00003673mPavirv00029652mPavirv00021282m
Physcomitrella patensPp1s66_154V6.1Pp1s131_34V6.1Pp1s131_32V6.1Pp1s66_157V6.2Pp1s66_157V6.1
Pp1s66_155V6.2Pp1s66_155V6.1Pp1s131_30V6.1Pp1s180_12V6.1
Phaseolus vulgarisPhvul.003G040000.1Phvul.008G028900.1Phvul.004G041600.1Phvul.009G203300.1Phvul.008G056100.2
Phvul.008G056100.1
Picea abiesMA_162652g0010MA_6359g0010.86.328MA_6359g0010.86.328MA_514703g0010MA_148285g0010
MA_147184g0010MA_18309g0010.83.291MA_18309g0010.83.291MA_69216g0010MA_10315336g0010
MA_7564826g0010MA_467383g0010MA_10361993g0010MA_10435046g0010
Populus trichocarpaPotri.010G156700.1Potri.008G097600.1Potri.004G117800.1Potri.015G060300.1Potri.017G099100.1
Potri.012G101100.1Potri.015G099300.1Potri.019G051700.1Potri.T057400.1
Prunus persicappa007588mppa007760mppa007756mppa017775mppa007906m
ppa007905mppa022800m.145.383ppa022800m.145.383ppa022800m.145.383ppa022800m.14.111
ppa022800m.14.111ppa022800m.14.111ppa022800m.384.458ppa022800m.384.458ppa022800m.384.458
Ricinus communis30138.m00394430174.m00908530147.m01447329790.m00080730128.m009012
Setaria italicaSi036300mSi030277mSi037048mSi024494m
Selaginella moellendorffii1400717644696340437552
Sorghum bicolorSb02g038770.1Sb01g015090.1Sb03g035320.1Sb06g031590.1
Thellungiella halophilaThhalv10021014mThhalv10013907mThhalv10022220mThhalv10013945mThhalv10019616m
Thhalv10013999m
Vitis viniferaGSVIVT01008552001GSVIVT01008133001GSVIVT01012244001GSVIVT01036557001GSVIVT01019151001
Volvox carteriVocar20009212mVocar20013853mVocar20014914m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)