y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g25660.1
FamilyGT47
Protein PropertiesLength: 461 Molecular Weight: 51521.3 Isoelectric Point: 8.6733
ChromosomeChromosome/Scaffold: 5 Start: 26869277 End: 26872263
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47413840
  RRLSVYVTDLPRALNHGLLDLYWSLPTADARIPASSDPDHPPPRAHPPYPASPLIRQYSAEYWLLASLLRPGPASSSAVSVVADWTEADVVFVPFFATLS
  AELELGWGATKGAFRRKEGNADYRRQREVVDRVTAHPAWRRSGGRDHVFVLTDPMAMWHVRAEIAPAILLVVDFGGWYKLDSKSAGSNSSHMIQHTQVSL
  LKDVIIPYTHLLPTLQLSENMDRPTLLYFKGAKHRHRGGLVREKLWDVMINEPGVVMEEGFPNATGREQSIKGMRTSEFCLHPAGDTPSSCRLFDAVASL
  CIPVIVSDDIELPFEGMIDYTEFSIFVSVGNAMRPKWLASYLKT
Full Sequence
Protein Sequence     Length: 461     Download
MKPPALLAVL LLLSLSFLLF LLRPTSPPFL LSAQTSGTDR RRLSVYVTDL PRALNHGLLD    60
LYWSLPTADA RIPASSDPDH PPPRAHPPYP ASPLIRQYSA EYWLLASLLR PGPASSSAVS    120
VVADWTEADV VFVPFFATLS AELELGWGAT KGAFRRKEGN ADYRRQREVV DRVTAHPAWR    180
RSGGRDHVFV LTDPMAMWHV RAEIAPAILL VVDFGGWYKL DSKSAGSNSS HMIQHTQVSL    240
LKDVIIPYTH LLPTLQLSEN MDRPTLLYFK GAKHRHRGGL VREKLWDVMI NEPGVVMEEG    300
FPNATGREQS IKGMRTSEFC LHPAGDTPSS CRLFDAVASL CIPVIVSDDI ELPFEGMIDY    360
TEFSIFVSVG NAMRPKWLAS YLKTISKQQK DEFRRNLAKV QHIFEYENSH HGSTGSAPED    420
GAVNHIWKKI HQKLPMIQEA IIREKRKPEG ASIPLRCHCT *                        480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin1.0e-6540385358+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE02830.102346023464OSJNBa0043A12.35 [Oryza sativa (japonica cultivar-group)]
GenBankEEC78225.102346023452hypothetical protein OsI_17865 [Oryza sativa Indica Group]
RefSeqNP_001137073.102346024458hypothetical protein LOC100217246 [Zea mays]
RefSeqXP_002448739.102346024456hypothetical protein SORBIDRAFT_06g032380 [Sorghum bicolor]
RefSeqXP_002533317.104346055478catalytic, putative [Ricinus communis]
Transmembrane Domains
StartEnd
522
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC9294112711914610
DY3051102711914610
DY3052352711914610
DY3050102671914570
FC9297522571914470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00053.1Aquca_013_00618.5Aquca_030_00332.1Aquca_009_00090.1Aquca_042_00116.2
Aquca_042_00116.1Aquca_023_00060.1Aquca_002_00598.3Aquca_002_00598.2Aquca_002_00598.1
Aquca_013_00618.4Aquca_013_00618.3Aquca_013_00618.2Aquca_013_00618.1
Arabidopsis lyrata482474313939494490338977476604
477609484930909677
Arabidopsis thalianaAT2G35100.1AT5G44930.2AT5G44930.1AT1G67410.1AT3G03650.1
AT1G74680.1AT3G45400.1AT1G34270.1AT5G16890.1
Brachypodium distachyonBradi2g53000.1Bradi1g63740.1Bradi1g24360.1Bradi2g59047.1Bradi4g26150.1
Bradi3g37030.1
Brassica rapaBra005369Bra023001Bra034000Bra036746Bra004088
Bra031981Bra038288Bra003790Bra023587Bra006378
Bra028047Bra008584
Carica papayaevm.model.supercontig_30.157evm.model.supercontig_43.42evm.model.supercontig_73.11evm.model.supercontig_43.87evm.model.supercontig_111.8
evm.model.supercontig_66.112
Capsella rubellaCarubv10025262mCarubv10026328mCarubv10009012mCarubv10020184mCarubv10016173m
Carubv10017118mCarubv10020282mCarubv10002876mCarubv10015810m
Citrus clementinaCiclev10031603mCiclev10031600mCiclev10015089mCiclev10031340mCiclev10019794m
Ciclev10019803mCiclev10000997mCiclev10019875m
Citrus sinensisorange1.1g014095morange1.1g014048morange1.1g011685morange1.1g011195morange1.1g010594m
orange1.1g011757morange1.1g011167morange1.1g011152m
Cucumis sativusCucsa.056260.1Cucsa.236080.1Cucsa.332740.1Cucsa.090160.1Cucsa.112780.1
Eucalyptus grandisEucgr.B03487.1Eucgr.E04252.1Eucgr.A02153.1Eucgr.K00083.1Eucgr.F02636.1
Eucgr.B00504.1Eucgr.F01298.1
Fragaria vescamrna20016.1-v1.0-hybridmrna12575.1-v1.0-hybridmrna27505.1-v1.0-hybridmrna06060.1-v1.0-hybridmrna26011.1-v1.0-hybrid
Glycine maxGlyma19g29730.1Glyma07g34570.1Glyma20g02340.1Glyma03g00910.1Glyma01g07060.1
Glyma17g10840.1Glyma06g20840.2Glyma08g10920.1Glyma04g33600.2Glyma05g27950.1
Glyma11g11550.1Glyma12g02010.3Glyma12g02010.1Glyma20g31360.1Glyma02g12920.2
Glyma10g36230.1Glyma05g01051.1Glyma04g33600.1
Gossypium raimondiiGorai.003G052700.2Gorai.009G332700.2Gorai.009G332700.1Gorai.005G267400.2Gorai.005G267400.1
Gorai.002G184100.2Gorai.005G168600.1Gorai.002G184100.1Gorai.013G196700.1Gorai.004G257200.1
Gorai.007G252800.1Gorai.003G052700.1Gorai.004G113300.1Gorai.005G075900.2Gorai.005G075900.1
Gorai.011G272600.1Gorai.002G184100.3Gorai.002G184100.4
Linum usitatissimumLus10036219Lus10038355Lus10039145Lus10013787Lus10033734
Lus10003870Lus10037016Lus10015791Lus10020308Lus10005684
Lus10002060Lus10031610Lus10013627Lus10024214
Malus domesticaMDP0000223942MDP0000195867MDP0000199026MDP0000175549MDP0000558976
MDP0000482184MDP0000419029MDP0000282146MDP0000266169MDP0000245563
MDP0000693745MDP0000279572MDP0000162640MDP0000200985MDP0000241559
MDP0000206538
Manihot esculentacassava4.1_023143mcassava4.1_006493mcassava4.1_007991mcassava4.1_022793mcassava4.1_032917m
cassava4.1_005963mcassava4.1_006429mcassava4.1_006323mcassava4.1_006525m
Medicago truncatulaMedtr4g078020.1Medtr4g077920.1Medtr3g085480.1Medtr4g084200.1Medtr7g087100.1
Medtr7g087120.1
Mimulus guttatusmgv1a009897mmgv1a010020mmgv1a005660mmgv1a022533mmgv1a004804m
mgv1a005938mmgv1a020908mmgv1a005291mmgv1a019485mmgv1a005764m
Oryza sativaLOC_Os01g59630.1LOC_Os04g57510.1LOC_Os07g37960.1LOC_Os01g69220.1LOC_Os12g03100.1
LOC_Os11g03410.1LOC_Os08g34020.2LOC_Os08g34020.1LOC_Os03g20850.1LOC_Os04g57510.2
Panicum virgatumPavirv00056704mPavirv00014489mPavirv00064353mPavirv00049701mPavirv00020813m
Pavirv00002856mPavirv00019260mPavirv00022063mPavirv00039830mPavirv00041807m
Pavirv00048056mPavirv00007724mPavirv00054522m
Physcomitrella patensPp1s307_10V6.2Pp1s307_10V6.1Pp1s237_53V6.1Pp1s169_88V6.1Pp1s45_211V6.1
Pp1s39_178V6.1Pp1s15_277V6.1Pp1s48_110V6.1Pp1s326_70V6.1Pp1s30_180V6.1
Pp1s106_65V6.1Pp1s34_108V6.1Pp1s34_108V6.2
Phaseolus vulgarisPhvul.002G097200.1Phvul.001G107400.1Phvul.003G190200.1Phvul.004G074100.1Phvul.002G174100.1
Phvul.009G187300.1Phvul.011G019900.1Phvul.007G087100.1
Picea abiesMA_10428894g0010MA_10427831g0010MA_104022g0010MA_168957g0010MA_10429747g0010
MA_10429909g0020MA_362407g0010MA_7513659g0010
Populus trichocarpaPotri.019G049800.3Potri.015G124800.2Potri.015G124800.1Potri.008G034500.1Potri.013G116200.1
Potri.012G124600.1Potri.013G067400.2Potri.013G067400.1Potri.019G044600.2Potri.019G044600.1
Potri.002G210000.1Potri.019G049800.2Potri.019G049800.1Potri.T071700.3Potri.T071700.2
Potri.T071700.1Potri.019G086800.1Potri.005G055000.1Potri.012G135800.1
Prunus persicappa005538mppa004914mppa004491mppa005995mppa004625m
ppa004627m
Ricinus communis29840.m00061530128.m00872829818.m00039330138.m00407929717.m000231
30073.m002257
Setaria italicaSi025194mSi001454mSi029615mSi015706mSi001155m
Si026308mSi010016mSi035588mSi002120m
Selaginella moellendorffii147086857471076759836299588
418827.96.275418827.96.275418827.290.358418827.290.358
Sorghum bicolorSb01g036720.1Sb02g036640.1Sb03g044100.1Sb08g001860.2Sb08g001860.1
Sb03g037670.1Sb07g021480.1Sb06g032380.1
Thellungiella halophilaThhalv10016654mThhalv10000882mThhalv10007515mThhalv10018590mThhalv10018515m
Thhalv10020580mThhalv10002514mThhalv10020554mThhalv10013266m
Vitis viniferaGSVIVT01012106001GSVIVT01014123001GSVIVT01008002001GSVIVT01029936001GSVIVT01036850001
GSVIVT01010454001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)