y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g26030.1
FamilyGT66
Protein PropertiesLength: 724 Molecular Weight: 81058.4 Isoelectric Point: 8.8868
ChromosomeChromosome/Scaffold: 5 Start: 27151357 End: 27155545
Descriptionstaurosporin and temperature sensitive 3-like b
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66316720
  RVSALALIYVLAFAVRLFSVLRYESMIHEFDPYFNYRTTLYLTEHGYGEFWNWFDSESWYPLGRVVGGTLFPGLMVTAALLHRLLHALSLAVHIREVCVL
  TAPFFAANTTLVAYAFGREIWDSGAGLVAAALIAVCPGYISRSVAGSYDNEGVAIFALLLTFYLFVRAVNTGSLAWALASAFGYFYMVSAWGGYVFIINL
  LPLYVLVLLVTGRYSQRLYVAYNCMYILGMLLGMQIRFVGFQHVQSGEHMAAMGVFFLLQVFFFLDWVKYMLNDVKLFKSFLRITLTCVITVGTLALGIG
  TASGYISPWTGRFYSLLDPTYAKDHIPIIASVSEHQPTAWSSFMFDFHILLFLFPAGLYFCFKRLSDATIFIVMYGLTSMYFAGVMVRLILVAAPAVCLI
  SAIAVSATMKNLTTLIRTKSKSPQTTSGKATGSKAAAKGAVDQPLPFQHNVAIALLLGAFYLLSRYAIHCTWVTSEAYSSPSIVLSARGHNGGRVIFDDY
  REAYYWLRQNTPTDAKIMSWWDYGYQITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSSDDINKFLWMVRIGGG
  VFPVIKEPDYLVNGEYRVDKGASHKMLNCLMYKLCYYRFGEL
Full Sequence
Protein Sequence     Length: 724     Download
MAAASAATTS ALEPLLRSLR LKTKQQELLL RVSALALIYV LAFAVRLFSV LRYESMIHEF    60
DPYFNYRTTL YLTEHGYGEF WNWFDSESWY PLGRVVGGTL FPGLMVTAAL LHRLLHALSL    120
AVHIREVCVL TAPFFAANTT LVAYAFGREI WDSGAGLVAA ALIAVCPGYI SRSVAGSYDN    180
EGVAIFALLL TFYLFVRAVN TGSLAWALAS AFGYFYMVSA WGGYVFIINL LPLYVLVLLV    240
TGRYSQRLYV AYNCMYILGM LLGMQIRFVG FQHVQSGEHM AAMGVFFLLQ VFFFLDWVKY    300
MLNDVKLFKS FLRITLTCVI TVGTLALGIG TASGYISPWT GRFYSLLDPT YAKDHIPIIA    360
SVSEHQPTAW SSFMFDFHIL LFLFPAGLYF CFKRLSDATI FIVMYGLTSM YFAGVMVRLI    420
LVAAPAVCLI SAIAVSATMK NLTTLIRTKS KSPQTTSGKA TGSKAAAKGA VDQPLPFQHN    480
VAIALLLGAF YLLSRYAIHC TWVTSEAYSS PSIVLSARGH NGGRVIFDDY REAYYWLRQN    540
TPTDAKIMSW WDYGYQITAM GNRTVIVDNN TWNNTHIATV GRAMSSYEDE AYEIMQSLDV    600
NYVLVVFGGV TGYSSDDINK FLWMVRIGGG VFPVIKEPDY LVNGEYRVDK GASHKMLNCL    660
MYKLCYYRFG ELTTEYGKPP GYDRVRGVEI GNKDVKLEYL EEAFTTSNWI VRIYKVKPPK    720
NRS*                                                                 780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT39.0e-2332605641+
COG1287COG12876.0e-6716721741+
pfam02516STT31.0e-13229674663+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN29281.10107237719unknown [Zea mays]
EMBLCBG76274.101672315707OO_Ba0005L10-OO_Ba0081K17.25 [Oryza officinalis]
RefSeqNP_001054248.1017231721Os04g0675500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131374.10107237720hypothetical protein LOC100192699 [Zea mays]
RefSeqXP_002448765.1097233720hypothetical protein SORBIDRAFT_06g032800 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A049971720238A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.000015296456123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.000015296456123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.000015296456123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vgp_A0.00045286296113A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
2850
93115
122144
154176
183205
220242
249271
281298
311333
370392
399421
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0360633462996440
GO8701293244017240
GO8695183253746980
GO869518146897020.74
GO869518157007140.74
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)