y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g27160.1
FamilyAA2
Protein PropertiesLength: 307 Molecular Weight: 33181.7 Isoelectric Point: 5.9464
ChromosomeChromosome/Scaffold: 5 Start: 28053333 End: 28054458
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA21362704e-21
  ASLPAPFFDVSQLLENFGRKGMENLDLVALSGAHTIGKASCGSFSNRFGENTAFMQALSKTCRDIPGWRQDLDVTTPNDFDNAYFVNLLQGKGLLTSDMA
  LVNDGRTRWLVEGFAGNHWWFFGQFGTSMSKLAHM
Full Sequence
Protein Sequence     Length: 307     Download
MPLGMIVVVA ALLSLPSALS LPSLISMPTA GKVDLALTDS CRDDIVRNAV QAARSSDIGV    60
TAGLLRISFH DCFPQGCDGS ILLTGPNTEQ DIRPQNGGLR QTALDLIESI RDKVHRACGW    120
RSVSCTDIMN LATREASLPA PFFDVSQLLE NFGRKGMENL DLVALSGAHT IGKASCGSFS    180
NRFGENTAFM QALSKTCRDI PGWRQDLDVT TPNDFDNAYF VNLLQGKGLL TSDMALVNDG    240
RTRWLVEGFA GNHWWFFGQF GTSMSKLAHM QGDQGRNGQI RDNCTRKNSG LAQDLVHAVE    300
EFVASV*                                                              360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase2.0e-1539267272+
cd00314plant_peroxidase_like1.0e-2139267286+
PLN03030PLN030306.0e-3943288291+
pfam00141peroxidase9.0e-4346252234+
cd00693secretory_peroxidase8.0e-9640286292+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB53488.103530541335CAA303715.1 protein [Oryza sativa]
EMBLCAB53489.101228927332CAA303716.1 protein [Oryza sativa]
RefSeqNP_001054338.101228927332Os04g0688200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001145841.10328912330hypothetical protein LOC100279351 [Zea mays]
RefSeqXP_002448824.103929156341hypothetical protein SORBIDRAFT_06g033860 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A04329022307A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1sch_B1.4013e-454628818294A Chain A, Peanut Peroxidase
PDB1sch_A1.4013e-454628818294A Chain A, Peanut Peroxidase
PDB1qo4_A4e-394528818304A Chain A, Peanut Peroxidase
PDB1pa2_A4e-394528818304A Chain A, Arabidopsis Thaliana Peroxidase A2
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE527944253442640
DR432337290402880
CT854010293453010
DY299682279432890
CK348235256702890
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_114_00002.1Aquca_023_00176.2Aquca_023_00176.1Aquca_023_00171.1Aquca_023_00181.1
Aquca_023_00178.1Aquca_023_00180.1Aquca_023_00179.1
Arabidopsis lyrata895007
Arabidopsis thalianaAT1G71695.1
Brachypodium distachyonBradi3g13590.1Bradi3g33940.1Bradi2g09600.1Bradi4g27680.1Bradi5g27130.1
Bradi5g27150.1Bradi2g17120.1Bradi5g27220.1Bradi5g27210.1Bradi5g27200.1
Bradi5g27170.1
Brassica rapaBra003918Bra016127
Carica papayaevm.model.supercontig_49.84
Capsella rubellaCarubv10020541m
Citrus clementinaCiclev10001726m
Citrus sinensisorange1.1g019278m
Eucalyptus grandisEucgr.I00020.1Eucgr.F04198.1Eucgr.F04195.1Eucgr.L02740.1Eucgr.J02563.1
Fragaria vescamrna27591.1-v1.0-hybrid
Glycine maxGlyma16g27890.1Glyma10g36680.1Glyma20g30910.1Glyma16g27880.1Glyma16g27900.1
Glyma10g36690.1Glyma16g27900.3
Gossypium raimondiiGorai.010G131800.1Gorai.005G077600.1
Linum usitatissimumLus10028735Lus10028689
Malus domesticaMDP0000176436.181.349MDP0000176436.181.349MDP0000642832
Manihot esculentacassava4.1_025536mcassava4.1_010796mcassava4.1_025889mcassava4.1_032882mcassava4.1_031254m
cassava4.1_010776mcassava4.1_027775mcassava4.1_013268mcassava4.1_021820m
Medicago truncatulaMedtr1g106870.1
Mimulus guttatusmgv1a009174m
Oryza sativaLOC_Os08g02110.1LOC_Os01g73220.1LOC_Os01g73170.1LOC_Os01g73200.1LOC_Os04g59150.1
LOC_Os01g73190.1LOC_Os04g59160.1LOC_Os04g59200.1LOC_Os04g59210.1LOC_Os04g59260.1
LOC_Os04g59190.1LOC_Os04g59150.2
Panicum virgatumPavirv00006034mPavirv00009935mPavirv00047812mPavirv00054325mPavirv00068704m
Pavirv00024512mPavirv00006543mPavirv00052301mPavirv00016398mPavirv00020256m
Pavirv00002644m
Phaseolus vulgarisPhvul.007G082600.1Phvul.007G082700.1Phvul.004G090800.1
Picea abiesMA_62726g0010MA_10427332g0010MA_10432033g0020MA_10275776g0010MA_66200g0010
MA_497337g0010MA_57932g0010MA_13490g0020MA_8813326g0010MA_10430613g0010.304.542
MA_10430613g0010.304.542MA_10432865g0020MA_10115394g0010MA_73034g0010MA_1125g0010.202.340
MA_1125g0010.202.340MA_170633g0010MA_466251g0010
Populus trichocarpaPotri.005G195600.1Potri.002G065300.1Potri.005G195700.1
Prunus persicappa007748m
Ricinus communis28644.m00090129863.m00107629863.m001072
Setaria italicaSi001960mSi002014mSi022514mSi002007mSi022669m
Si022524mSi022622m
Selaginella moellendorffii177321230656
Sorghum bicolorSb06g033840.1Sb03g046810.1Sb03g046760.1Sb06g033870.1Sb06g033850.1
Sb06g033860.1
Thellungiella halophilaThhalv10018753mThhalv10018936m
Vitis viniferaGSVIVT01034574001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)