y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g27200.1
FamilyAA2
Protein PropertiesLength: 325 Molecular Weight: 34317.1 Isoelectric Point: 5.4035
ChromosomeChromosome/Scaffold: 5 Start: 28076678 End: 28077765
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2372901.30321e-43
  SIVRTSVEAALEEEIALAAGLLRVFFHDCFPQGCDGSVFLTGRNSEQSLGPNLTLQPRALQLVDAIRAKAHAACGPTVSCADISALATRDAVVFSGGPNY
  TVPLGNLDSLTPASAKAVMTLPSPITSSVAALFEAFRTRGLVELTDLVALSGVHTVGRAGCRFFADRSAKQDDTFSKKLAANCSVEPDRLQNLDVITPDV
  FDNGYFKALMFNQGVFTSDMALVKDKDTAPIVKRFAGSKDKFFKQFVKSMEKLV
Full Sequence
Protein Sequence     Length: 325     Download
MATAMVAAVL LLLTISPAAA AALSPHFHAD SCPELESIVR TSVEAALEEE IALAAGLLRV    60
FFHDCFPQGC DGSVFLTGRN SEQSLGPNLT LQPRALQLVD AIRAKAHAAC GPTVSCADIS    120
ALATRDAVVF SGGPNYTVPL GNLDSLTPAS AKAVMTLPSP ITSSVAALFE AFRTRGLVEL    180
TDLVALSGVH TVGRAGCRFF ADRSAKQDDT FSKKLAANCS VEPDRLQNLD VITPDVFDNG    240
YFKALMFNQG VFTSDMALVK DKDTAPIVKR FAGSKDKFFK QFVKSMEKLV NAPRPDGNVG    300
EIRRSCSSPN GDDGEKEDFA VASA*                                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase8.0e-1982289218+
cd00314plant_peroxidase_like2.0e-2262291259+
pfam00141peroxidase2.0e-4259274216+
PLN03030PLN030305.0e-5127310301+
cd00693secretory_peroxidase7.0e-10726307297+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAH69305.10531112320TPA: class III peroxidase 63 precursor [Oryza sativa (japonica cultivar-group)]
EMBLCAJ86340.10531013327H0814G11.7 [Oryza sativa (indica cultivar-group)]
GenBankEEC78299.10531013319hypothetical protein OsI_18021 [Oryza sativa Indica Group]
RefSeqNP_001054342.10531112320Os04g0688600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001054343.10531013319Os04g0689000 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A0173103305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1qo4_A0233113305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1pa2_A0233113305A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1qgj_B0233102299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A0233102299A Chain A, Arabidopsis Thaliana Peroxidase N
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK209770284273100
EG396425254593100
DV472353231592890
JG297310240282670
DR740918246272720
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_114_00002.1Aquca_023_00176.2Aquca_023_00176.1Aquca_023_00171.1Aquca_023_00181.1
Aquca_023_00178.1Aquca_023_00180.1Aquca_023_00179.1
Arabidopsis lyrata895007
Arabidopsis thalianaAT1G71695.1
Brachypodium distachyonBradi3g13590.1Bradi3g33940.1Bradi2g09600.1Bradi4g27680.1Bradi5g27130.1
Bradi5g27150.1Bradi2g17120.1Bradi5g27220.1Bradi5g27210.1Bradi5g27170.1
Bradi5g27160.1
Brassica rapaBra003918Bra016127
Carica papayaevm.model.supercontig_49.84
Capsella rubellaCarubv10020541m
Citrus clementinaCiclev10001726m
Citrus sinensisorange1.1g019278m
Eucalyptus grandisEucgr.I00020.1Eucgr.F04198.1Eucgr.F04195.1Eucgr.L02740.1Eucgr.J02563.1
Fragaria vescamrna27591.1-v1.0-hybrid
Glycine maxGlyma16g27890.1Glyma10g36680.1Glyma20g30910.1Glyma16g27880.1Glyma16g27900.1
Glyma10g36690.1Glyma16g27900.3
Gossypium raimondiiGorai.010G131800.1Gorai.005G077600.1
Linum usitatissimumLus10028735Lus10028689
Malus domesticaMDP0000176436.181.349MDP0000176436.181.349MDP0000642832
Manihot esculentacassava4.1_025536mcassava4.1_010796mcassava4.1_025889mcassava4.1_032882mcassava4.1_031254m
cassava4.1_010776mcassava4.1_027775mcassava4.1_013268mcassava4.1_021820m
Medicago truncatulaMedtr1g106870.1
Mimulus guttatusmgv1a009174m
Oryza sativaLOC_Os08g02110.1LOC_Os01g73220.1LOC_Os01g73170.1LOC_Os01g73200.1LOC_Os04g59150.1
LOC_Os01g73190.1LOC_Os04g59160.1LOC_Os04g59200.1LOC_Os04g59210.1LOC_Os04g59260.1
LOC_Os04g59190.1LOC_Os04g59150.2
Panicum virgatumPavirv00006034mPavirv00009935mPavirv00047812mPavirv00054325mPavirv00068704m
Pavirv00024512mPavirv00006543mPavirv00052301mPavirv00016398mPavirv00020256m
Pavirv00002644m
Phaseolus vulgarisPhvul.007G082600.1Phvul.007G082700.1Phvul.004G090800.1
Picea abiesMA_62726g0010MA_10427332g0010MA_10432033g0020MA_10275776g0010MA_66200g0010
MA_497337g0010MA_57932g0010MA_13490g0020MA_8813326g0010MA_10430613g0010.304.542
MA_10430613g0010.304.542MA_10432865g0020MA_10115394g0010MA_73034g0010MA_1125g0010.202.340
MA_1125g0010.202.340MA_170633g0010MA_466251g0010
Populus trichocarpaPotri.005G195600.1Potri.002G065300.1Potri.005G195700.1
Prunus persicappa007748m
Ricinus communis28644.m00090129863.m00107629863.m001072
Setaria italicaSi001960mSi002014mSi022514mSi002007mSi022669m
Si022524mSi022622m
Selaginella moellendorffii177321230656
Sorghum bicolorSb06g033840.1Sb03g046810.1Sb03g046760.1Sb06g033870.1Sb06g033850.1
Sb06g033860.1
Thellungiella halophilaThhalv10018753mThhalv10018936m
Vitis viniferaGSVIVT01034574001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)