y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10015952m
FamilyCBM43
Protein PropertiesLength: 477 Molecular Weight: 52344.5 Isoelectric Point: 7.7352
ChromosomeChromosome/Scaffold: 3 Start: 8840488 End: 8842115
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433874701.9e-26
  WCVAIDGASEAELGQALNFACGRSNETCAALAPGKECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCK
GH17373610
  IGINYGKLGNNLPSPYQSINLIKTIKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADKWVATNVLPFYPQTRIRFVLVGNEVLSYSS
  DQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFREDLAVPVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDYALFES
  NSTYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPDVRLAISETGWPNSGDIHETGANVLNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQ
  KPGSGTERHWGILNPDGTPIYEIDF
Full Sequence
Protein Sequence     Length: 477     Download
MSHLALFLFT LLVLSSSCCY AIGSQNNRTV LALASRIGIN YGKLGNNLPS PYQSINLIKT    60
IKAGHVKLYD ADPETLKLLS KTNLYVTIMV PNDQIISVGS DQAAADKWVA TNVLPFYPQT    120
RIRFVLVGNE VLSYSSDQDK QIWANLVPAM RKVVNSLRAR GIHNIKVGTP LAMDALRSSF    180
PPSSGAFRED LAVPVMLPLL KFLNGTNSFF FLDVYPYFPW STDPVNNHLD YALFESNSTY    240
TDPQTGLVYT NLLDQMLDSV IFAMTKLGYP DVRLAISETG WPNSGDIHET GANVLNAATY    300
NRNLIKKMTA NPPLGTPARR GAPIPTFLFS LFNENQKPGS GTERHWGILN PDGTPIYEID    360
FTGTRPVSSF GELPKPDNNV PFKGNVWCVA IDGASEAELG QALNFACGRS NETCAALAPG    420
KECYAPVSVS WHASYAFSSY WAQFRNQSSQ CYFNGLARET TTNPGNERCK FPSVTL*       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53093.0e-527635280+
pfam07983X81.0e-1638745776+
smart00768X83.0e-3038747185+
pfam00332Glyco_hydro_174.0e-12737361326+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM64490.101547615476beta-1,3-glucanase, putative [Arabidopsis thaliana]
GenBankABK28569.101547615476unknown [Arabidopsis thaliana]
EMBLCAA49513.1064761474beta-1,3-glucanase homologue [Brassica napus]
RefSeqNP_189019.101547615476glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqNP_193144.1014761478MEE48 (maternal effect embryo arrest 48); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghs_B0373611306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0373611306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB2cyg_A0373611312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghr_A0373611306A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1aq0_B0373611306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX0515792881904770
EX0505502781564330
FY430678279182960
EX0504612721864570
CX1906692592194770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)