y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10024927m
FamilyCBM43
Protein PropertiesLength: 131 Molecular Weight: 14791.1 Isoelectric Point: 9.514
ChromosomeChromosome/Scaffold: 4 Start: 13043742 End: 13044134
DescriptionCarbohydrate-binding X8 domain superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM43401183.5e-25
  WCVDNPYAHFTRVIWNLKRACENGADCSPMEKGRRCQDLDYYRSRASYAFNDYYQKNPTPRNCDFGGAAVLTIQDPSTS
Full Sequence
Protein Sequence     Length: 131     Download
MKTRMLINLV VLISVARTAE AIGRLAAQQN TSIILTFTLW CVDNPYAHFT RVIWNLKRAC    60
ENGADCSPME KGRRCQDLDY YRSRASYAFN DYYQKNPTPR NCDFGGAAVL TIQDPSTSKP    120
LHICKNKIKL *                                                         180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X81.0e-113910977+
smart00768X82.0e-233911881+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG38222.12e-1840119104183GPI-anchored protein [Zea mays]
RefSeqNP_001131448.14e-1740119109188hypothetical protein LOC100192780 [Zea mays]
RefSeqNP_001142053.12e-1840119116195hypothetical protein LOC100274209 [Zea mays]
RefSeqNP_181821.1011291127glycosyl hydrolase family protein 17 [Arabidopsis thaliana]
RefSeqXP_002441577.19e-204011874153hypothetical protein SORBIDRAFT_09g029700 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jon_A0.000000002401161390A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK19522780401194e-21
BE35899580401188e-20
FL92153480401182e-19
CF44556980401182e-18
DR97140780401193e-18
Orthologous Group
SpeciesID
Arabidopsis lyrata903671
Arabidopsis thalianaAT2G42930.1
Glycine maxGlyma15g23435.2
Sequence Alignments
Phylogeny