y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus clementina
Cazyme IDCiclev10020260m
FamilyGT58
Protein PropertiesLength: 427 Molecular Weight: 48445.5 Isoelectric Point: 9.6889
ChromosomeChromosome/Scaffold: 3 Start: 45616197 End: 45621279
Descriptionasparagine-linked glycosylation 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT58303920
  LIIMDALLVALIITYVPYTKIDWDAYMSQVSGFLEGERDYSNLKGDTGPLVYPAGFLYVYSAIQYITGGEVYSAQIFFAFLYLINLGIVLFVYVKTDVLP
  WWGLSLLCLSKRVHSIFVLRLFNDCFAMTFLHAALALLLDQRWHLGLIIFSVAVSIKMNVLLYAPPLFLLLLKALGIFGVISTLASAALVQILFGFPFLI
  SHPVAYVSRAFNLGRVFIHFWSVNFKFVPEPVFVSKGFAISLLTTHLVVLAAFSHYRWCKHEGGLLNFLHSRYVAMKMKFAGLSSSNSSSRILKKEHIVT
  TMFAGNFIGIVCARSLHYQFYLWYFYSLPYLLWRTPFPTLLRLILFMGVELCWNVYPSNIYSS
Full Sequence
Protein Sequence     Length: 427     Download
MARRSATHVK HDASFLGIFK SSKVAFAFGL IIMDALLVAL IITYVPYTKI DWDAYMSQVS    60
GFLEGERDYS NLKGDTGPLV YPAGFLYVYS AIQYITGGEV YSAQIFFAFL YLINLGIVLF    120
VYVKTDVLPW WGLSLLCLSK RVHSIFVLRL FNDCFAMTFL HAALALLLDQ RWHLGLIIFS    180
VAVSIKMNVL LYAPPLFLLL LKALGIFGVI STLASAALVQ ILFGFPFLIS HPVAYVSRAF    240
NLGRVFIHFW SVNFKFVPEP VFVSKGFAIS LLTTHLVVLA AFSHYRWCKH EGGLLNFLHS    300
RYVAMKMKFA GLSSSNSSSR ILKKEHIVTT MFAGNFIGIV CARSLHYQFY LWYFYSLPYL    360
LWRTPFPTLL RLILFMGVEL CWNVYPSNIY SSLLLLCLHL VILYGLWSAP TEYPYVDDKP    420
TTKKNK*                                                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05208ALG35.0e-15226392373+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK95338.104842649422unknown [Populus trichocarpa]
GenBankACF84701.104842356430unknown [Zea mays]
RefSeqNP_001143883.104842356430hypothetical protein LOC100276684 [Zea mays]
RefSeqXP_002267192.1024266437PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002320351.104842649422predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
2446
79101
108130
145167
174196
206228
328350
360382
389411
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT046057325553790
DV154672267343000
EX104259280233010
DR94229629012900
DR924536269222900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00758.1Aquca_003_00758.2Aquca_003_00758.3
Arabidopsis lyrata904250
Arabidopsis thalianaAT2G47760.3AT2G47760.1AT2G47760.2
Brachypodium distachyonBradi2g04440.1
Brassica rapaBra000461.29.139Bra004431
Carica papayaevm.model.supercontig_9.209
Capsella rubellaCarubv10023173m
Citrus sinensisorange1.1g014346morange1.1g015618m.102.369orange1.1g015618m.102.369orange1.1g015618m.30.104orange1.1g015618m.30.104
Cucumis sativusCucsa.205720.1
Eucalyptus grandisEucgr.H01160.1
Fragaria vescamrna10569.1-v1.0-hybrid
Glycine maxGlyma19g39740.1Glyma03g37130.1
Gossypium raimondiiGorai.008G011100.2Gorai.008G011100.1
Linum usitatissimumLus10031921Lus10035085
Malus domesticaMDP0000161757
Manihot esculentacassava4.1_008035m
Medicago truncatulaMedtr7g108620.1
Mimulus guttatusmgv1a006267mmgv1a008112m
Oryza sativaLOC_Os01g07720.4LOC_Os01g07720.2
Panicum virgatumPavirv00058096mPavirv00012164m
Physcomitrella patensPp1s58_150V6.1
Phaseolus vulgarisPhvul.001G205800.1
Picea abiesMA_10426799g0010
Populus trichocarpaPotri.014G131600.2Potri.014G131600.1Potri.014G131600.3
Prunus persicappa005841m
Ricinus communis30129.m000370
Setaria italicaSi001564m
Selaginella moellendorffii96090
Sorghum bicolorSb03g004440.1
Thellungiella halophilaThhalv10001458m
Vitis viniferaGSVIVT01027976001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny