y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDCre01.g000500.t1.3
FamilyGT77
Protein PropertiesLength: 656 Molecular Weight: 72778.6 Isoelectric Point: 7.3903
ChromosomeChromosome/Scaffold: 1 Start: 70246 End: 77235
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT77173112.7e-27
  RINYKGSDTAYHWGSHHWKLTTWNKVHIIKAVYEFGVNVIHSDTDVVWFGDPLPFFQQQLQERHGGDGGDDGIGHKVRAKWDAAASEVGAAGATPAAADA
  AAAGSSGWWAPPHVAVATDSVSTMNRRGDRGLEDSPQPYAPINTGIYFLRQWSGGAAFLDEWLSWQERDVGHDQDGFNTLARGFFFHRDPDLRLPVFPDA
  HTRITLPRGSTSGSGTNDGSERDVGGVGDGNTTGEWAAPRTFRAAYSNTTGVSFLPASMFGNTYTYVNARLWEKLKHPLYAIHWVWGGSTLESKR
Full Sequence
Protein Sequence     Length: 656     Download
MGAQGITDHC FNAPQDRINY KGSDTAYHWG SHHWKLTTWN KVHIIKAVYE FGVNVIHSDT    60
DVVWFGDPLP FFQQQLQERH GGDGGDDGIG HKVRAKWDAA ASEVGAAGAT PAAADAAAAG    120
SSGWWAPPHV AVATDSVSTM NRRGDRGLED SPQPYAPINT GIYFLRQWSG GAAFLDEWLS    180
WQERDVGHDQ DGFNTLARGF FFHRDPDLRL PVFPDAHTRI TLPRGSTSGS GTNDGSERDV    240
GGVGDGNTTG EWAAPRTFRA AYSNTTGVSF LPASMFGNTY TYVNARLWEK LKHPLYAIHW    300
VWGGSTLESK RQNMRDAMKF HDEPDYYTSP NLVTFDLDLL PVPPTFNSWF STEHMIRFHV    360
QAANYQLQQA YYAFAIALIA NRTLVMPRFQ CYCSKNWYQT QQCRINFEKA TTFPFTCALS    420
HVLRVKKLEA GFRLPDNTEY SGHRVFIREY SFLDNPKVPD SLKKSFVEIV PSQMPRAANL    480
GADELVVSVE PAPRGYGQRV TVAAPLVDRE LRQVLGRFKG VRVLHFPQPA RTLSGFSTYA    540
TWEQYDAEIQ KHVAYWCCRA PGDMRAYNLT ERLQLVALPP ERYKSLPALT AAGDPTGAPA    600
PGSSSYLHEA PPLPPRAAGG RPWCDGVVAR HVARHGRAEG RLGELLQCIG DDAGG*        660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans0.00414519654+
pfam03407Nucleotid_trans1.0e-997365+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001692532.103559100552predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001697686.102456626568hypothetical protein CHLREDRAFT_195312 [Chlamydomonas reinhardtii]
RefSeqXP_001700329.1016131520predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001700358.10161272621predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001701267.1010559236676hypothetical protein CHLREDRAFT_179139 [Chlamydomonas reinhardtii]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FD8332042891864720
AV626006791982760
AV626006471511970
BI7180391145436566.02558e-44
BM003285771779e-37
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre09.g416650.t1.2Cre13.g574100.t1.2
Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)