y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDCre02.g119100.t1.2
FamilyCE10
Protein PropertiesLength: 539 Molecular Weight: 55269.1 Isoelectric Point: 6.7695
ChromosomeChromosome/Scaffold: 2 Start: 6820583 End: 6823915
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101074871.6e-38
  VLYGDKPRQRLDLYYPPSSRGAPATTEGATYPLVIYVTGGAWTIGYKAWGALLGRRLSEQGVLVACLDYRNFPQGDALDMLEDVNTGICWVLRRVHRLGG
  DPDNVTLVGQSAGGHLAGLSLLRQAEQAASGRSALGATPSWSPGCIKAFVGVSGAFDLVGLASHRGGTFRGLLDRILAVDASGMSSADGGGGGAARGVVQ
  GIVTTAAVSASEVAAAATLSAEDRDAPPPGGPAVPPALPDIEQGGGGGSAAVSSAIIAQGSDKHGETPLLRSPVSSSAPGSLADGQAPAGAAAGGAMAGT
  RRGGTRVPAYDALSPLEAARRMGSDAAALLPDVLLVHGTADKTVPCEGSARLAEALQAAGATRPVRCVLVPGKTHTAFLLE
Full Sequence
Protein Sequence     Length: 539     Download
MDDDDPGQVV GPRWPPGAPD DLTVPIITSS EPVLGPRTRE HATASQRWCR PFRAVWNALS    60
AVVHVVVLVF KIIHIVLALA VYSMLLLPGF LRMIYYYFFN KCVVRGVLYG DKPRQRLDLY    120
YPPSSRGAPA TTEGATYPLV IYVTGGAWTI GYKAWGALLG RRLSEQGVLV ACLDYRNFPQ    180
GDALDMLEDV NTGICWVLRR VHRLGGDPDN VTLVGQSAGG HLAGLSLLRQ AEQAASGRSA    240
LGATPSWSPG CIKAFVGVSG AFDLVGLASH RGGTFRGLLD RILAVDASGM SSADGGGGGA    300
ARGVVQGIVT TAAVSASEVA AAATLSAEDR DAPPPGGPAV PPALPDIEQG GGGGSAAVSS    360
AIIAQGSDKH GETPLLRSPV SSSAPGSLAD GQAPAGAAAG GAMAGTRRGG TRVPAYDALS    420
PLEAARRMGS DAAALLPDVL LVHGTADKTV PCEGSARLAE ALQAAGATRP VRCVLVPGKT    480
HTAFLLEDPM RGGRDLLMDC VLGAVLGGGE DDPAIGGRVY SSLCPGFLCT AAGWVCPF*     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00312Esterase_lipase0.003117214107+
pfam07859Abhydrolase_30.00114021476+
COG2272PnbA0.00113821390+
COG0657Aes1.0e-8109214107+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG46361.107028885293carboxylesterase-like protein [Zea mays]
RefSeqNP_001146610.107028285287hypothetical protein LOC100280207 [Zea mays]
RefSeqXP_001702446.10845381455carboxyesterase-related protein [Chlamydomonas reinhardtii]
RefSeqXP_001702447.1010328553224carboxyesterase-related protein [Chlamydomonas reinhardtii]
RefSeqXP_001702447.10414505230321carboxyesterase-related protein [Chlamydomonas reinhardtii]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c7b_B0.0000000411622561162A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library
PDB2c7b_A0.0000000411622561162A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library
PDB1c7i_A0.0000000410922072192A Chain A, Thermophylic Pnb Esterase
PDB1c7j_A0.0000000410922072192A Chain A, Pnb Esterase 56c8
PDB1qe3_A0.0000000410922072192A Chain A, Pnb Esterase
Transmembrane Domains
StartEnd
6284
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO253675208782830
FC918186208782830
FC903644208782830
DY282217208782830
DY270152208782830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi1g34707.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1Glyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)