y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDCre03.g195600.t1.2
FamilyGH37
Protein PropertiesLength: 653 Molecular Weight: 68642.7 Isoelectric Point: 5.0097
ChromosomeChromosome/Scaffold: 3 Start: 6545729 End: 6549170
Descriptiontrehalase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH372676500
  TETETLLREALPRLIAHHGYWTSGPKLVRVRSSAGGEGGGAGSGDGTGGGQEGGGTGERTVFELSRYHAELYEPRPESFREDLNLVEGAGLGPEAARALY
  CDIASAAESGWDFSTRWFVGGDSLAHTRTTQIVPADLNAWLYRTELDIAHMAARLGDSATRDAFAARAAERAAAMDLLMWSDADGCWHDLLLQPSPAPPS
  LRQATDGAATAPPPATAKAVEAQEEDAGAVQEDGSAGVYPTQQRAGVYASNWVPLWCGVAAPGSSRAVAAAAGLRSSGLLQPGGLLTSLCRSGQQWDAPN
  SWPPLVHMAVEGLERSGAPGAAEAAAGLARSYVAGCRAAWGATGHMHEKYDAMVPGGVGRGGEYVPQVGFGWSNGVLMTLLRKY
GH37342240
  FADSKHFVDCPVLRPWELVAADWEQLKVDGVTQEALKCFIASNFGPPGSDLEAVLPASWHEEPPAWLAGLPEEEARAFGAAVHQLWKTLCRKVSSDVLAN
  PDRHTLLPLPQPFIVPGDRFRECYNWDSYWVILGLLASGLLPAARQLLTNLLGLVDVWGFVPNGARAYYTNRSQPPLLSAMVAAVAAATAT
Full Sequence
Protein Sequence     Length: 653     Download
MDVGLPTTPL QTTQLNSQAT WHEIIWKVSD AGLFADSKHF VDCPVLRPWE LVAADWEQLK    60
VDGVTQEALK CFIASNFGPP GSDLEAVLPA SWHEEPPAWL AGLPEEEARA FGAAVHQLWK    120
TLCRKVSSDV LANPDRHTLL PLPQPFIVPG DRFRECYNWD SYWVILGLLA SGLLPAARQL    180
LTNLLGLVDV WGFVPNGARA YYTNRSQPPL LSAMVAAVAA ATATAQEESR GREGAGATGV    240
NGNGRAQSAS GAGVSNNHSS SNSTGGTETE TLLREALPRL IAHHGYWTSG PKLVRVRSSA    300
GGEGGGAGSG DGTGGGQEGG GTGERTVFEL SRYHAELYEP RPESFREDLN LVEGAGLGPE    360
AARALYCDIA SAAESGWDFS TRWFVGGDSL AHTRTTQIVP ADLNAWLYRT ELDIAHMAAR    420
LGDSATRDAF AARAAERAAA MDLLMWSDAD GCWHDLLLQP SPAPPSLRQA TDGAATAPPP    480
ATAKAVEAQE EDAGAVQEDG SAGVYPTQQR AGVYASNWVP LWCGVAAPGS SRAVAAAAGL    540
RSSGLLQPGG LLTSLCRSGQ QWDAPNSWPP LVHMAVEGLE RSGAPGAAEA AAGLARSYVA    600
GCRAAWGATG HMHEKYDAMV PGGVGRGGEY VPQVGFGWSN GVLMTLLRKY GA*           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1626TreA3.0e-35330651324+
pfam01204Trehalase1.0e-5033212183+
pfam01204Trehalase2.0e-61327651332+
PLN02567PLN025678.0e-8716212208+
PLN02567PLN025671.0e-122278651374+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABO61746.103665144561trehalase [Physcomitrella patens subsp. patens]
RefSeqXP_001693125.1016521594trehalase-like protein [Chlamydomonas reinhardtii]
RefSeqXP_001769611.103665138547predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001775598.102965119535predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001775772.103665145558predicted protein [Physcomitrella patens subsp. patens]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wyn_D02864721499A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f
PDB2wyn_C02864721499A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f
PDB2wyn_B02864721499A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f
PDB2wyn_A02864721499A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f
PDB2jjb_D02864721499A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f
Metabolic Pathways
Pathway NameReactionECProtein Name
trehalose degradation II (trehalase)TREHALA-RXNEC-3.2.1.28α,α-trehalase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CV7355613471094550
HO4816643193396520
EX3295853203306461.96182e-44
FQ4803533173306467.00649e-43
FQ4526013173306468.99634e-43
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00232.1Aquca_037_00231.2Aquca_037_00231.1
Arabidopsis lyrata914188
Arabidopsis thalianaAT4G24040.1
Brachypodium distachyonBradi3g31410.3Bradi3g31410.2Bradi3g31410.1
Brassica rapaBra013756Bra019249
Carica papayaevm.model.supercontig_15.13
Capsella rubellaCarubv10006565m
Chlamydomonas reinhardtiiCre03.g195600.t1.2.34.224Cre03.g195600.t1.2.34.224Cre03.g195600.t1.2.267.650Cre03.g195600.t1.2.267.650
Citrus clementinaCiclev10023271mCiclev10033306mCiclev10001132mCiclev10001012mCiclev10001134m
Ciclev10000621mCiclev10000674m
Citrus sinensisorange1.1g041103m.84.216orange1.1g037772m.219.456orange1.1g037772m.219.456orange1.1g047407morange1.1g041103m.217.446
orange1.1g041103m.217.446orange1.1g037772m.86.219orange1.1g037772m.86.219orange1.1g041103m.84.216
Cucumis sativusCucsa.303880.1
Eucalyptus grandisEucgr.E01027.1Eucgr.E01027.2
Fragaria vescamrna25101.1-v1.0-hybrid
Glycine maxGlyma05g36580.2Glyma05g36580.1
Gossypium raimondiiGorai.003G075200.1Gorai.007G020500.2Gorai.007G020500.1
Linum usitatissimumLus10023035Lus10032434Lus10023034Lus10032435
Malus domesticaMDP0000315187.328.541MDP0000235673.82.325MDP0000315187.82.325MDP0000315187.82.325MDP0000235673.82.325
MDP0000235673.328.541MDP0000315187.328.541MDP0000235673.328.541
Manihot esculentacassava4.1_015916mcassava4.1_004491mcassava4.1_023202m
Mimulus guttatusmgv1a003260m
Oryza sativaLOC_Os10g37660.1
Panicum virgatumPavirv00009281mPavirv00064436mPavirv00062867mPavirv00064435m
Physcomitrella patensPp1s196_77V6.1Pp1s194_104V6.3Pp1s116_30V6.1Pp1s194_104V6.2Pp1s194_104V6.1
Pp1s137_159V6.1
Phaseolus vulgarisPhvul.002G301500.2Phvul.002G301500.1
Picea abiesMA_31368g0020MA_31368g0010
Populus trichocarpaPotri.001G087100.1Potri.003G144000.1Potri.006G068300.1Potri.003G143900.1Potri.001G087100.2
Prunus persicappa003514m
Ricinus communis28842.m00094530068.m002541
Setaria italicaSi034760m
Selaginella moellendorffii90006177119156751109304
Sorghum bicolorSb01g031280.1
Thellungiella halophilaThhalv10024684m
Vitis viniferaGSVIVT01019610001
Volvox carteriVocar20003462m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny