y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDCre06.g289850.t1.3
FamilyGH13
Protein PropertiesLength: 770 Molecular Weight: 86227.6 Isoelectric Point: 6.2759
ChromosomeChromosome/Scaffold: 6 Start: 6089722 End: 6100307
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132395639.2e-30
  LPRVQALGYNAIQLMAIQEHAYYGSFGYHVTNPFAVSSRSGTPEELKALIDEAHRRGIAVLLDVVHSHISGNQDDGLAGFDMGQREQDNYFKQGEAGYHK
  LWDSRCLNYANWECQRYLLSNLRYWLEEYQFDGFRFDGVTSMLYHHHGIHTSFSGDYNEYLGTSTNVDAVVYLMMANRLVHDLVPSAVTIAEDVSGMPAL
  CRPVAEGGVGFDARLNMSIPDTWIKLLKHVRDEHWRMQDIVSALCNRRYTEKSIGYAESHDQALVGDQTIAFRLMGPEMYSGMSALTEATPVVSRGVALH
  KLIRLVTMALGGEGWLSFMGNEFGH
Full Sequence
Protein Sequence     Length: 770     Download
MAARPLQGPR ALLPVPTAST AAPLRATAQA PASTSSSAAD EGDGLGVIAV DPALANFKGH    60
LEYRWAQYRR TLDSITAGAG SLAAFAEGYK YFGFNREDGA IVYREWAPAA QAAALIGDFS    120
KWEPVWMTRD EWGVWSVRLE DVDGKPAIPH RSRVKVRLQH PHGWWMDRVP AWIKWAAAEQ    180
RMDAKYDGIY WDPPAAERHQ WRHQRPPRPA ALRIYEAHVG MSSETGKVAS YSEFTDTVLP    240
RVQALGYNAI QLMAIQEHAY YGSFGYHVTN PFAVSSRSGT PEELKALIDE AHRRGIAVLL    300
DVVHSHISGN QDDGLAGFDM GQREQDNYFK QGEAGYHKLW DSRCLNYANW ECQRYLLSNL    360
RYWLEEYQFD GFRFDGVTSM LYHHHGIHTS FSGDYNEYLG TSTNVDAVVY LMMANRLVHD    420
LVPSAVTIAE DVSGMPALCR PVAEGGVGFD ARLNMSIPDT WIKLLKHVRD EHWRMQDIVS    480
ALCNRRYTEK SIGYAESHDQ ALVGDQTIAF RLMGPEMYSG MSALTEATPV VSRGVALHKL    540
IRLVTMALGG EGWLSFMGNE FGHPEWIDFP RDGNGWSHHY CRRQWSLADT DHLRYKFLQA    600
WDAAMMALDN HYGFLASPHQ WVTHMDEPEQ ILVFERGPLL FVFNWSPIAD REAYRVAVPA    660
PGKWRVALDS DAWDYGGAGR VFHDADHFSD PEPAGTSRDR EHSIRVLAPA RTCAVYYNAD    720
THTHWRERPQ AQQQEGGAEA EAPHHTYGLA PAATQTAGGL SVGSGDEVV*               780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029603.0e-751142105+
PLN03244PLN032441.0e-121146716572+
PLN02960PLN029601.0e-166146717577+
PLN02447PLN02447040725689+
cd11321AmyAc_bac_euk_BE0210602393+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN05321.103472081775starch branching enzyme I [Populus trichocarpa]
EMBLCAA54308.108720517761,4-alpha-glucan branching enzyme [Manihot esculenta]
EMBLCBI18866.103372084779unnamed protein product [Vitis vinifera]
RefSeqXP_001695391.10337201690starch branching enzyme [Chlamydomonas reinhardtii]
RefSeqXP_002284841.102072048756PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A0377203694A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A0377203694A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0377203694A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0377203694A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB1m7x_D7.00649e-4410670932605A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO6191675991297200
HO794536693427200
HO7776386351007200
HO4581234013327160
HO7776384750960.007
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)