y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDCre09.g415600.t2.1
FamilyCBM20
Protein PropertiesLength: 444 Molecular Weight: 47350 Isoelectric Point: 5.8609
ChromosomeChromosome/Scaffold: 9 Start: 7688722 End: 7693657
DescriptionCarbohydrate-binding-like fold
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM201172026.2e-28
  VQVRFCLKYRTSYGQSVKIIGSHAKLGNWDINKALVLSWTDGDRWVATIELPAGSVYEYKYVLVDHDGRSALAWQGGSNSVLAIGD
Full Sequence
Protein Sequence     Length: 444     Download
MQRTSQAFAS GSNLQKRTTR DATVAQGVRG KAQGLSTQVV SNPRSLAAGA SLVPRRSTAN    60
WVAEVSTSAQ RLLEAPASYR QGGAQANAGP NALMATDGKA SSLRKLVVDG VDDSPNVQVR    120
FCLKYRTSYG QSVKIIGSHA KLGNWDINKA LVLSWTDGDR WVATIELPAG SVYEYKYVLV    180
DHDGRSALAW QGGSNSVLAI GDQDEQGVEV QDNWHNNPGQ AAVVAGGQTL TRETKLQAWA    240
EEMKQYRALA RSAQFELSRK AEELQASKAQ VARLKMELSM SLKAREELES RLADLEGENL    300
SLRAQVAQSQ IAMKSTLEEA IKLLQQEIEE GEEELYSTGL GDEELEAAAS GSGSSGASSS    360
SSNGSGWGWG RSKEAETVYA GSNGSSSNGS GGSNGATFER FGFRLSGNTF DQPQQTGSEF    420
GHNSGSRSNN NVLADWRTRL GSQ*                                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02859E_set_AMPKbeta_like_N4.0e-17119214101+
cd02856E_set_GDE_Isoamylase_N2.0e-18113214106+
smart01065CBM_21.0e-1811720290+
pfam00686CBM_204.0e-2211720188+
cd05467CBM203.0e-30118214100+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAL53465.12e-1811122374188glucan 1,4-alpha-glucosidase (ISS) [Ostreococcus tauri]
EMBLCAL56006.12e-188020018127unnamed protein product [Ostreococcus tauri]
RefSeqXP_001418210.13e-1911723613135predicted protein [Ostreococcus lucimarinus CCE9901]
RefSeqXP_001696825.10944431323hypothetical protein CHLREDRAFT_150073 [Chlamydomonas reinhardtii]
RefSeqXP_002508103.12e-20117294291483carbohydrate-binding module family 20 protein [Micromonas sp. RCC299]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1kum_A0.00000006117195787A Chain A, Glactose Oxidase C383s Mutant Identified By Directed Evolution
PDB1kul_A0.00000006117195787A Chain A, Glactose Oxidase C383s Mutant Identified By Directed Evolution
PDB1acz_A0.00000006117195787A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, 5 Structures
PDB1ac0_A0.00000006117195787A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, Minimized Average Structure
PDB2vn7_A0.0000003117200497582A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, Minimized Average Structure
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BP0949559591031.99965e-42
FD84454464931562e-26
DC994677951192136e-23
FD844543531041567e-21
GR823708951062002e-17
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2Bradi2g55380.1
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08820.1Glyma03g08930.1Glyma18g42781.1
Glyma03g08910.2Glyma1061s50.2Glyma1061s50.1Glyma03g08850.2Glyma03g08850.1
Glyma0165s00200.1Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1
Glyma19g30580.1.16.102Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.011G147600.1Gorai.010G128900.7.16.102
Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)