y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDCre10.g451600.t2.1
FamilyGH18
Protein PropertiesLength: 2500 Molecular Weight: 460900 Isoelectric Point: 5.0816
ChromosomeChromosome/Scaffold: 10 Start: 4408462 End: 4443440
DescriptionGlycosyl hydrolase family protein with chitinase insertion domain
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH183326622.8e-34
  RVVAYYTNRRPDKSPACLASVADVETTALQRAAAATHVIFAHVKPNAETISVDLANERDGPVLANLDGNLFNVNPDIRVLVSVGGPGGLDSDYSRLVLNE
  QSVVGFANATVTFLNAYNLDGAELSWPNLQSEQVEGYTALLEILSATLRPAGKLLSLAVPPREVYVSMDWGRLGLLVDMINFQGFDLEGDEVLGASPYVE
  TPLFDCQEAEGLSVNSLVDLILAAGAPPQLLTVVASSMGRSFVLDGDGFVGGPGSPGPCMGVEGLLDQSEIKLLLPPGAARHDPEAFANVGPFAANQYAH
  WEDAYSIVNKVCFARSHCLGGVGLWDVDGDS
Full Sequence
Protein Sequence     Length: 2500     Download
MLFRDEVRQK QRAGRLVAVL GARARDLLRV CIVAIASGSR GFSPLTTWLD LTGSPFSIDV    60
TNTTTRSYVF TDVTGDRASD MVFFDQPTLR LAYMPSNRNN KLVDDTDGDG TTWFELSTVS    120
GRCASLGEDC FLITSDVNND KLNDIALVYL DRVTETEEFY LTLVTTSPPA PLNWYMTSAA    180
VFPRGACTSP QAVALGQFVG LDGSLDGTIA GTNQPQLLCL SSYDQRIYVG GLGVWGSLPG    240
PVTSLHVRDV DVDGRDDLLI FTEVGSYYLV STGASFGPAL PTAAWLSPSS VSLAVPLTLD    300
LGQTDQTASS VVASADVIGA APVEHRCGPP RRVVAYYTNR RPDKSPACLA SVADVETTAL    360
QRAAAATHVI FAHVKPNAET ISVDLANERD GPVLANLDGN LFNVNPDIRV LVSVGGPGGL    420
DSDYSRLVLN EQSVVGFANA TVTFLNAYNL DGAELSWPNL QSEQVEGYTA LLEILSATLR    480
PAGKLLSLAV PPREVYVSMD WGRLGLLVDM INFQGFDLEG DEVLGASPYV ETPLFDCQEA    540
EGLSVNSLVD LILAAGAPPQ LLTVVASSMG RSFVLDGDGF VGGPGSPGPC MGVEGLLDQS    600
EIKLLLPPGA ARHDPEAFAN VGPFAANQYA HWEDAYSIVN KVCFARSHCL GGVGLWDVDG    660
DSYGELLGAV GRAVLGDPAI CTEYSPPECT NTVSTRGSED LGSPELVATL GDSEFLLYQV    720
RKNWPDARDH CQQIGGDLVS VTSRGEAGVV YSLITAWASS GQLGPDDIYS GRDVYVWLGG    780
SDAAQEGRFV WAESGADFTF TSWAGGQPDG RFGGEDCVAT TVRLAGSSGA GLRQVISSEA    840
LWNDVGCTAA LPFVCQRDTA LARSLLRAAK EVPWLSATYH VLAPAEEGDP GLMLTQPEAN    900
KLCRSLGGEL PTLTDPWVRE DLTSQYHRDL PTHTWLGLRS YGDGQLFWND GTFTTDGMLN    960
AWEPGEFGDA ACGLIVGPSG ANVTVSAGTL YSFWNATTFQ GAIRVASPPP PPPRPPSPGP    1020
PGPKPPSPPP RPANLTPPAP PPGLPNAPPS PVYEDLTIYN LTDYFAPQVQ MYSVFLPQGV    1080
YSLSCNERMP TTCQTGMPAV SLTPNFYCLT RPNGRAYVVP GKELPSMPLY LSTERACAAA    1140
CMLNFRCVYY TWLPRFRASF LPTDEVLGRP NQLQDQGSCY LMGRPWMPNS DRLPKLLSEI    1200
TDSDRVCFRS GSIFSGDTLP ISDDTLIQPP AAVGPLFGNP AAVAANPAGT PPATPFSLLC    1260
GSDGAAAPLL SSLTFLVDNG TRGIQDVGAA CAGTVSAGVL GSVSAEGYEL RVRQLQRPVI    1320
QSYTARCGPG GVTGMLGSYD NRGMCQVSLT CASGAVEPVL PPTASRNCTA AASFFDYECP    1380
PGQLAIGLQG LFLNAATYTA SDNILAAIRM LCAAVPVAMV APSPPSPPLP PPSPPPAGRR    1440
RAALETASAA WRRAAAAATD AGSSSSSSSS SNTQAAATGA FFQELMQSRR VDLGINGGGS    1500
ARRRLQQTSP PSPSPPSPKP PSPSPPSPTP PSPKPPSPKP PSPSPPSPLP PAPPKPPLPP    1560
SPKPPSPSPP LPPRPPSPSP PSPKPPSPSP PSPKPPSPSP PSPKPPTLPV PPSPRSPPSP    1620
PAPPPAPPRP PRPPPAPKPP RPPAPKPPSP VPFPPRASPP FPPSPPPVPS PPNPPPSPAP    1680
QIPTPPSPPP RPPAPPSPPP IPPTPSPPPA PPPRPPSPPP PPPSPPPPPS PSPPPPPPPA    1740
NVTYADVILC RDCSPLFGEG PGAASPLVTT SRQGVLRCPQ RHIITQLQTP IVSAGALPLQ    1800
SGAVANQPLT GLGGVCAPLA SAPGAVDTVS AGLPAVPTLP PISGQPFNVS IVGGAACPTG    1860
IVQVTGLHLS FRIGPPANPS YVNNLAVRCR TVATPLPLPT APVGYPSHRP FSYTCPPSTV    1920
LSEIFWNTQE WPASSPGTVR NQPVPVITSL VFKCTPWTVP TPAAPIPPPS PFSQIEANSM    1980
TSLTLACPLG QFLTSVYGRF DSAPANMGGV AFVRSLSITC SGPTTVTREV STIMAPTAAT    2040
TPFTSAVCPG GIGALTARTL AVPGAPTTTP PALLSLDAHC YDTQLHTRKL SFLPPALSNA    2100
APQVADRISE LTDRCLGLTL VSGITVLRSM FSGGVLITSG VPTSSFLHGI KVSCFDVPEP    2160
NPPALAVSAQ LPPNQLPAAP AVTFKYECPA GSKVVSVLSR VDADDDLLNV RIECDNAPLG    2220
DAESLASIAA RLTPFFAPPQ IFVANCTNCT TAANVSSMGY GQRRYISPDI AISAPRTSYV    2280
IERTCPLGIA GIINTATSSR IVPELGGAAT PVSSAALPSS VVTGATIALF DVLLDWGNAV    2340
AFCMAQDGAL MTIEDELQRL AVGSVVQEWA AENTGDAVLG VWIGARRTGN GLYDFTYQDN    2400
TPMGGYVAPW APGEPNDLSG VEDCVELVVN VTSGLVSWND RVCTGLVRRP LCKLLPKATV    2460
EGANSADVAP PNVQISATNN DELSFYNVSL TWYEGLNFCQ                          2520
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00037CLECT1.0e-1023292444116+
cd00037CLECT2.0e-1138583984128+
cd00037CLECT3.0e-1342024330131+
cd00037CLECT2.0e-22713857145+
pfam00704Glyco_hydro_182.0e-23332648334+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001698335.1033141210022362hypothetical protein CHLREDRAFT_187642 [Chlamydomonas reinhardtii]
RefSeqXP_001698335.10.000000000061478151423732409hypothetical protein CHLREDRAFT_187642 [Chlamydomonas reinhardtii]
RefSeqXP_001698335.101769290924583598hypothetical protein CHLREDRAFT_187642 [Chlamydomonas reinhardtii]
RefSeqXP_001698335.102909313836803909hypothetical protein CHLREDRAFT_187642 [Chlamydomonas reinhardtii]
RefSeqXP_001698335.103234433239344977hypothetical protein CHLREDRAFT_187642 [Chlamydomonas reinhardtii]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1wb0_A5e-2136767231353A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B
PDB1waw_A5e-2136767231353A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase
PDB1hkm_A4e-2036766331344A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase
PDB1hkj_A4e-2036766331344A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase
PDB1hki_A4e-2036766331344A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BU65309096423743321e-24
GR283225133107612049e-24
GR283226133107612041e-23
GR283228133107612041e-23
GR283236130107612012e-23
Orthologous Group
SpeciesID
Chlamydomonas reinhardtiiCre01.g002800.t1.3g5228.t2g5228.t1Cre10.g451600.t3.1Cre10.g458350.t3.1
Cre10.g458350.t2.1Cre10.g458350.t1.3
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny