y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDCre12.g513400.t1.3
FamilyGH81
Protein PropertiesLength: 2500 Molecular Weight: 395407 Isoelectric Point: 7.6307
ChromosomeChromosome/Scaffold: 12 Start: 3542907 End: 3560382
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81102917080
  ATGASAFPYPTNSWWSSWSHNRTIGSTRGVGDEPVQMHPWRARVMPSYLELVPPGVQWDVKPGYIVPAYDRNISITAAEGFVSRRIVDFNEMGVTFEWLT
  ATGVSGGPGSMRVTMLQGTPFLTARFVGVTPVVTQHVASPLVVGTGSGQVGKSFKVTSNGRISFKYYFSQTVTADINDTRVALTAPFTGVMRIAVLNSTI
  APLGILSSVDSVMQEAAYDANADIYPTSATMTPGYQTPAQSGTGSERGIVRIKFTTASMSGTPTGQLMMMTMPHHRTHLLYPAVPGAGAARVRMDDMRGE
  LVSVLGDEWFLGYDLAAVSAVGWGARNTIADSTRRQSIISTLLAEATSWPGLTPRDDSYYGASDMAAIGRMAIIADEMAALESASASSLAAAATSLRTKL
  KAALDARLNAAGTGNNASLVYDTTWGGLIVYKDARYSLEHNFGNRVYNDHHYHYGYYLMGAALLGKADPTWLTANLPALTTLVRDFANPNKADSYFPLAR
  MMDWWEGHSWAGGMQVFGDGKNQESTSESVNGYYAVALLGRALAQAGVAGAADLTRWGQLLMAVEVSGAQHYYQMTEAATAFPVVYPKPFRDNKAVGILW
  NSKVDYSTWFGSTPIYIHAIQYIPFTPASEVLLRREWMVESYPVASFNLSNLAVTPCWKQFGDAALAMLNSTGTATAWSR
GH81137140
  ATLLTTAALRSRPPTNAWWTSWLQYTGADTTPINMNPYMVKVLPTGLWVASPRDYTQLDGTCLGGACIRFDFDYKLQITTTTGVSVVEVESYDDLSVTFV
  WRAVAGGGVVMRSTLLQGLPYVTVEFVAVKPRVVVITGAILAANPSTWAAATKFKVPLNNQLTWVIYTSSSVAATSTSTNFEATTTFTGRWRLATVTHAM
  AQPYGWRKADLAANAAAFETLLDSCAAAVPTGARVTLGIQPAAQSPTGADRAIQQIDYTVVSLDGTASTNLLMFTMPHHREALVSPSPNPAAYLIVKSPR
  GNLKTVVGTKWVLAFELPSITWAAPGGAGSNSAYLQTIANQITATDVNAAGGTDVLPNAAPQLADMARLYQIATELSPTYTALSASAVTLRSNLLTMLNQ
  WLTSSDLSNTRVLSYDSKWGGIIAYGVAKWATGSGGNRDGWGKNNAYTNHLEDYGPLLYAAAVLAKANVTWGNDVTPSVMALVRDLANPRADLSDPYFPF
  ARHMDWYEGHSWSTGLLSRTSDGGMVNWGKYQERSGSAVAAYYSIGLFGAAIGNADLQKWGQVLAGIEAAGARNYFQILATGTEAYPAGTFYVCNDAGTE
  TSYPGYPTNGKHVPGKVYQSYVWYWTEAGGVSQDAAGYTALQLIPFLPGASELTQRKPWIQEAYDSIAGSSTATPWTAFRALLGSATSAAQQGTSWTEVQ
  VN
GH81188025590
  ATGASAFPYPTNSWWSSWSHNRTIGSTRGVGDEPVQMHPWRARVMPSYLELVPPGVQWDVKPGYIVPAYDRNISITAAEGFVSRRIVDFNEMGVTFEWLT
  ATGVSGGPGSMRVTMLQGTPFLTARFVGVTPVVTQHVASPLVVGTGSGQVGKSFKVTSNGRISFKYYFSQTVTADINDTRVALTAPFTGVMRIAVLNSTI
  APLGILSSVDSVMQEAAYDANADIYPTGATMTPGYQTPAQSGTGSERGIVRIKFTTASMSGTPTGQLMMMTMPHHRTHLLYPAVPGAGATRVRMDDMRGE
  LVSVLGDEWFLGYDLAAVSAVGWGARNTIADSTRRQSIISTLLAEATSWPGLTPRDDSYYGASDMAAIGRMAIIADEMAALESASASSLAAAATSLRTKL
  KAALDARLNAAGTGNNASLVYDTTWGGLIVYKDARYSLEHNFGNRVYNDHHYHYGYYLMGAALLGKADPTWLTANLPALTTLVRDFANPSKADAYFPLAR
  MMDWWEGHSWAGGMQVFGDGKNQESTSESVNGYYAVALLGRALAQAGVAGAADLTRWGQLLMAVEVSGAQHYYQMTEAATAFPVVYPKPFRDNKAVGILW
  NSKVDYATWFGSTPIYIHAIQYIPFTPASEVLLRREWMVESYPVASFNLSNLAVTPCWKQFGDAALAMLNSTGTATAWSR
GH81272234040
  PYPTNTWWSPLSHLNLDNVDFKTMLHPWHVKVQDSQLEMVAPGAYWSVVGDTISSAYSREVGLGAVEALGRRSIVSGNEMGATVEWLTDAGVSGGDGSMR
  VTLLQGCPFITARYVGLTPIIRHKVTEAPLIVGTGLGKIGTSFKVENNAGITYKYYFSQRVTVDITSGSVVVTSPLPFTGVLRVAVLKSSMADAIALQPL
  LNVDVATLAAVEQVYDANSDIYPVGASVKYGYQTPAQSGTGSERGVLRIKFTTASMSGTPTGQLMMLSLPHQRPRLLYPPAPTGQLVRVNDFRGELVHRL
  GDDWVLAYDLPPVSFTSLNGVTNTARRDAIATTLINDISGWSGMEPRNNGYLGTSDLAAIGRMLSIAEEIAPQLPSGTTKDWLLSQVVWARTRLTDSLDA
  RLRTSTINSSFVYDSTWGGLILLGDAKDGQLSNYEHRTYNSHHSSGGYLLAAAAALAKSNSTWLAARQANVMALLRDFANPNKADPYFPFARHMDWWEGH
  SWGTGTQVFVDGKNQDSSSEAVNAYYAVAQLGAAAGDADLRRWGQLLTAIEIAGAQHYFQSPSNGAPASPYASPFKDNKVVGRLWNGQVDRGTTRWGDAV
  LTNQASHYAPFTAVSPLLLRTDWIGESYAVAAADTTTATAAGTVGWSFIANMARALTTDVSGAWNAISGVSPTDARFFGNWPS
Full Sequence
Protein Sequence     Length: 2500     Download
MVFTNADVES PNATLLTTAA LRSRPPTNAW WTSWLQYTGA DTTPINMNPY MVKVLPTGLW    60
VASPRDYTQL DGTCLGGACI RFDFDYKLQI TTTTGVSVVE VESYDDLSVT FVWRAVAGGG    120
VVMRSTLLQG LPYVTVEFVA VKPRVVVITG AILAANPSTW AAATKFKVPL NNQLTWVIYT    180
SSSVAATSTS TNFEATTTFT GRWRLATVTH AMAQPYGWRK ADLAANAAAF ETLLDSCAAA    240
VPTGARVTLG IQPAAQSPTG ADRAIQQIDY TVVSLDGTAS TNLLMFTMPH HREALVSPSP    300
NPAAYLIVKS PRGNLKTVVG TKWVLAFELP SITWAAPGGA GSNSAYLQTI ANQITATDVN    360
AAGGTDVLPN AAPQLADMAR LYQIATELSP TYTALSASAV TLRSNLLTML NQWLTSSDLS    420
NTRVLSYDSK WGGIIAYGVA KWATGSGGNR DGWGKNNAYT NHLEDYGPLL YAAAVLAKAN    480
VTWGNDVTPS VMALVRDLAN PRADLSDPYF PFARHMDWYE GHSWSTGLLS RTSDGGMVNW    540
GKYQERSGSA VAAYYSIGLF GAAIGNADLQ KWGQVLAGIE AAGARNYFQI LATGTEAYPA    600
GTFYVCNDAG TETSYPGYPT NGKHVPGKVY QSYVWYWTEA GGVSQDAAGY TALQLIPFLP    660
GASELTQRKP WIQEAYDSIA GSSTATPWTA FRALLGSATS AAQQGTSWTE VQVNVSADPT    720
MVDITGGSFS VKHSKASLLY WVASRSFGAV PVPVPSPSPP SPAPSPAPPS PASLSPPPSP    780
APPSPKPPSP PPSPAPPSPA PPSPPPSPAP PSPAPPGPPP SPAPPSPKPP SPPPSPAPPS    840
PAPPSPPPFP APPSPAPPSP PPSPEAPLNA PPSPPPSPAP PSPAPPSPAP PSPPPSPEPP    900
SPAPPSPPPS PAPPSPAPPS PPPSPAPPSP APPSPPPSPV PPSPAPPSPP PSPAPPSPAP    960
SPPASPSPVS VSPVGWTPLD VSIVPTSAPP AAFSRYTNTW YKGNYPAWGD WTNPSFDNVT    1020
YAPQVDLFAT GASAFPYPTN SWWSSWSHNR TIGSTRGVGD EPVQMHPWRA RVMPSYLELV    1080
PPGVQWDVKP GYIVPAYDRN ISITAAEGFV SRRIVDFNEM GVTFEWLTAT GVSGGPGSMR    1140
VTMLQGTPFL TARFVGVTPV VTQHVASPLV VGTGSGQVGK SFKVTSNGRI SFKYYFSQTV    1200
TADINDTRVA LTAPFTGVMR IAVLNSTIAP LGILSSVDSV MQEAAYDANA DIYPTSATMT    1260
PGYQTPAQSG TGSERGIVRI KFTTASMSGT PTGQLMMMTM PHHRTHLLYP AVPGAGAARV    1320
RMDDMRGELV SVLGDEWFLG YDLAAVSAVG WGARNTIADS TRRQSIISTL LAEATSWPGL    1380
TPRDDSYYGA SDMAAIGRMA IIADEMAALE SASASSLAAA ATSLRTKLKA ALDARLNAAG    1440
TGNNASLVYD TTWGGLIVYK DARYSLEHNF GNRVYNDHHY HYGYYLMGAA LLGKADPTWL    1500
TANLPALTTL VRDFANPNKA DSYFPLARMM DWWEGHSWAG GMQVFGDGKN QESTSESVNG    1560
YYAVALLGRA LAQAGVAGAA DLTRWGQLLM AVEVSGAQHY YQMTEAATAF PVVYPKPFRD    1620
NKAVGILWNS KVDYSTWFGS TPIYIHAIQY IPFTPASEVL LRREWMVESY PVASFNLSNL    1680
AVTPCWKQFG DAALAMLNST GTATAWSRTL ALPYTAADGS PNFFGGWASH PKTALLYWIA    1740
SREGAPMPSP PPLPPAAPPP PSPSPAPPSP PQPSPAPPSP PPAPAPPSPA PSPVPPSPAP    1800
PSPPSVPAPP SPAPSPPSPP FNSPVSWTPL DVSIVPTSAP PAAFSRYTNT WYKGNYPAWG    1860
DWTNPSFDNV TYAPQVDLFA TGASAFPYPT NSWWSSWSHN RTIGSTRGVG DEPVQMHPWR    1920
ARVMPSYLEL VPPGVQWDVK PGYIVPAYDR NISITAAEGF VSRRIVDFNE MGVTFEWLTA    1980
TGVSGGPGSM RVTMLQGTPF LTARFVGVTP VVTQHVASPL VVGTGSGQVG KSFKVTSNGR    2040
ISFKYYFSQT VTADINDTRV ALTAPFTGVM RIAVLNSTIA PLGILSSVDS VMQEAAYDAN    2100
ADIYPTGATM TPGYQTPAQS GTGSERGIVR IKFTTASMSG TPTGQLMMMT MPHHRTHLLY    2160
PAVPGAGATR VRMDDMRGEL VSVLGDEWFL GYDLAAVSAV GWGARNTIAD STRRQSIIST    2220
LLAEATSWPG LTPRDDSYYG ASDMAAIGRM AIIADEMAAL ESASASSLAA AATSLRTKLK    2280
AALDARLNAA GTGNNASLVY DTTWGGLIVY KDARYSLEHN FGNRVYNDHH YHYGYYLMGA    2340
ALLGKADPTW LTANLPALTT LVRDFANPSK ADAYFPLARM MDWWEGHSWA GGMQVFGDGK    2400
NQESTSESVN GYYAVALLGR ALAQAGVAGA ADLTRWGQLL MAVEVSGAQH YYQMTEAATA    2460
FPVVYPKPFR DNKAVGILWN SKVDYATWFG STPIYIHAIQ                          2520
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03639Glyco_hydro_814.0e-32278599344+
pfam03639Glyco_hydro_814.0e-4227103344683+
COG5498ACF21.0e-5418842516686+
pfam03639Glyco_hydro_815.0e-7118642511680+
pfam03639Glyco_hydro_812.0e-7210131660680+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001702995.10477251679predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001702995.1096917266801437predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001702995.101032178515052227predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001702995.10182325776831437predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001702995.102669345014562227predicted protein [Chlamydomonas reinhardtii]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO355474453214725930
HO355474453129617420
BP09297683303631185.00264e-43
HO3554744752847451e-29
HO355474326307233958e-24
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)