y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDCre12.g556350.t1.3
FamilyGH28
Protein PropertiesLength: 859 Molecular Weight: 88861.3 Isoelectric Point: 8.8575
ChromosomeChromosome/Scaffold: 12 Start: 7451058 End: 7455179
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28424280
  DTVLQASAERSSYGRTQHTWYLLYFLGCRNCSLSGGGTVRGCAEAFMPPQLPPQPQPQAPLPAADAGSAGTAGSGHVEDTSGMDVSNWADPSCRVRRQCR
  PRLVGLVGCEHVALSDVALADSAFWTLHVRRSRHVELSGLRVSGNRRFPNNDGIDIDGSAHVTIRNCTVSTADDAVCLKTTLGQAERDPDPGLRALEASA
  AKAAKAAAGCKGQGRSQDNGNRSSSSSSSGDGGGNEACGQALRLPPPRATEHVLVEDCVLRSRSAAVKLGSESRADMTNITFRRVRVLDSNRGLGIQLRD
  WGDVRDVAFEDVSVTTSRVTAGRWWGGGEPIYVTALPRHLDAWGRVGQLRNVSFRRVAATATGGLVVVAGSPESVVRGVTLQDVTLR
Full Sequence
Protein Sequence     Length: 859     Download
MARAVMAQRW TQQLYILFAP GRTYLLGSLL LSGSVQLVVP ADTVLQASAE RSSYGRTQHT    60
WYLLYFLGCR NCSLSGGGTV RGCAEAFMPP QLPPQPQPQA PLPAADAGSA GTAGSGHVED    120
TSGMDVSNWA DPSCRVRRQC RPRLVGLVGC EHVALSDVAL ADSAFWTLHV RRSRHVELSG    180
LRVSGNRRFP NNDGIDIDGS AHVTIRNCTV STADDAVCLK TTLGQAERDP DPGLRALEAS    240
AAKAAKAAAG CKGQGRSQDN GNRSSSSSSS GDGGGNEACG QALRLPPPRA TEHVLVEDCV    300
LRSRSAAVKL GSESRADMTN ITFRRVRVLD SNRGLGIQLR DWGDVRDVAF EDVSVTTSRV    360
TAGRWWGGGE PIYVTALPRH LDAWGRVGQL RNVSFRRVAA TATGGLVVVA GSPESVVRGV    420
TLQDVTLRIL PPPPAPHQPP LALAIAAAAA AAVPGSPAAV QGPRGALEAA GAKEKAGGNA    480
QGASLLGQAA GVRATTPAAG RRRLLELVTA AAGQQRPDRS AGHDTAAGAA SANAAAAAAA    540
DGGAQRGSGD GHAGTDVAGD ATDWPLGVKL DLRPGPYDVR RWPLSAAGPV LAQYVQGMAM    600
WDVDIQLVAP APGHGAEGQA GSEDGQPWPA PPPPPRSWVT GWLDWWLARP PPWCVELVAR    660
TVHGLQARGV RVRVVHADEA SGELPVPDAS DAGAPGARGY RPDHSWLQGR GTATGALWLV    720
VPTVMLAVVA ITACIGVGLT QWPRRRQARM QPLPTTDSDE GFGLVAMSGG RSMAGAGSSE    780
DIASASVWAA AAAAGGAPVA AAAAPPLPPL PPTGLRSLCL ERSRALGSSE SLSKKTSATL    840
RTWSPKVMPK ESYPTEGV*                                                 900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5434PGU17.0e-528835368+
PLN02188PLN021886.0e-7123225105+
PLN03003PLN030035.0e-914122181+
pfam00295Glyco_hydro_283.0e-912922195+
COG5434PGU11.0e-1314122181+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001694178.101643421367predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001694178.10597786352541predicted protein [Chlamydomonas reinhardtii]
RefSeqZP_03013960.12e-291642763397hypothetical protein BACINT_01520 [Bacteroides intestinalis DSM 17393]
RefSeqZP_05253998.12e-291643163401glycoside hydrolase [Bacteroides sp. 4_3_47FAA]
RefSeqZP_05553838.13e-321643241368conserved hypothetical protein [Lactobacillus coleohominis 101-4-CHN]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3jur_D0.000000021722162267A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_C0.000000021722162267A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_B0.000000021722162267A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_A0.000000021722162267A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
Transmembrane Domains
StartEnd
717739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG152537213122241e-19
AM816440971282244e-19
GO608172207122186e-19
FE4729961372934297e-19
AM816440502983470.002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00836.1
Arabidopsis lyrata324272
Arabidopsis thalianaAT3G57790.1
Brachypodium distachyonBradi4g33660.1
Brassica rapaBra035299
Carica papayaevm.TU.contig_34124.1
Capsella rubellaCarubv10019007m
Citrus clementinaCiclev10005155mCiclev10004869m
Citrus sinensisorange1.1g038762m
Cucumis sativusCucsa.242950.1
Eucalyptus grandisEucgr.K01816.4Eucgr.K01816.1Eucgr.K01816.3Eucgr.K01816.2
Fragaria vescamrna00558.1-v1.0-hybrid
Glycine maxGlyma19g32550.1
Gossypium raimondiiGorai.006G139700.1
Linum usitatissimumLus10026318Lus10042350
Malus domesticaMDP0000248311
Manihot esculentacassava4.1_024146m
Medicago truncatulaMedtr7g092470.1
Mimulus guttatusmgv1a005515m
Oryza sativaLOC_Os09g31270.1
Panicum virgatumPavirv00061210mPavirv00068607m
Physcomitrella patensPp1s116_9V6.1Pp1s375_23V6.1
Phaseolus vulgarisPhvul.001G138000.1
Populus trichocarpaPotri.016G051200.1
Prunus persicappa005960m
Ricinus communis27810.m000670
Setaria italicaSi029777m
Selaginella moellendorffii437695105243
Sorghum bicolorSb02g028280.1
Thellungiella halophilaThhalv10005936m
Vitis viniferaGSVIVT01033349001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny