y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma0060s00320.2
FamilyGT1
Protein PropertiesLength: 357 Molecular Weight: 39581 Isoelectric Point: 6.8655
ChromosomeChromosome/Scaffold: 60 Start: 67388 End: 68707
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11903308.2e-27
  VLVTVAEALEESGFPFLWSLMEGLMDLLPNGFLERTKMRGKVVSWAPQSQVLAHDSSGVFVSNCGANSVTESVCGGVPMICRPFFGDEGVAGRLIEDVWE
  IGVVMEGKVFTENGVLKSLNLILAQEEGKKIRDNALKVKQT
Full Sequence
Protein Sequence     Length: 357     Download
MPNSMENKHV AVFAFPFGTH FMALLNLVLK LAQTAPNCSF SFICTQKSNA THFNRPHIPK    60
NIKAYSISDG IPMSHAQLAN HPIEKVNLFL KTGPQNLQKD SSLLVAQSLN VPWIAFWPPM    120
SCSLSLYFYI DLIRDWISFL ERETMFSRTL VSLAKVLPQA KAVVMNLFEE LDPPLFVQDM    180
RSKLQSLLYV LVTVAEALEE SGFPFLWSLM EGLMDLLPNG FLERTKMRGK VVSWAPQSQV    240
LAHDSSGVFV SNCGANSVTE SVCGGVPMIC RPFFGDEGVA GRLIEDVWEI GVVMEGKVFT    300
ENGVLKSLNL ILAQEEGKKI RDNALKVKQT VQDATRPEGQ AARDLKTLIE IISTTS*       360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02448PLN024482.0e-229355465+
PLN00164PLN001641.0e-22194353183+
PLN02562PLN025624.0e-25193325137+
PLN02555PLN025552.0e-26194350168+
PLN02410PLN024101.0e-27191354170+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU17764.1063554447unknown [Glycine max]
GenBankADC96620.1063554447UF3GT [Glycine max]
DDBJBAF49289.1073554447UDP-glucose:anthocyanin 3',5'-O-glucosyltransferase [Clitoria ternatea]
DDBJBAF49297.1053551446UDP-glucose:anthocyanidin 3-O-glucosyltransferase [Clitoria ternatea]
DDBJBAF49298.1053551446UDP-glucose:flavonoid 3-O-glucosyltransferase [Clitoria ternatea]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A013531451A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1z_A013531451A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1x_A013531451A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A0935415454A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbf_A0935415454A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanin biosynthesis (delphinidin 3-O-glucoside)RXN-7815EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside)PELUDP-RXNEC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside)RXN1F-775EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN1F-775EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
Transmembrane Domains
StartEnd
1029
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV26450123661910
BE8231381502063550
BU0816281951693180
CO9812542411693550
FE9689581651913550
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)