y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g01270.1
FamilyGT66
Protein PropertiesLength: 779 Molecular Weight: 86514 Isoelectric Point: 9.5915
ChromosomeChromosome/Scaffold: 01 Start: 908127 End: 916913
Descriptionstaurosporin and temperature sensitive 3-like A
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66237140
  LAFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWVLNSLNIPLSVETVCV
  FTAPIFSAFASWATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWGGYTFIIN
  LIPMHVLLCIVTGRYSSRLYIAYAPLVVLGTLLAALVPVVGFNAVMTSEHFASFLVFIIIHVVALVHYIKGILSPKMFKVAVALVVSVGLAVCCAMVAVL
  VALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFSPLSDASSFVVLYIVTSVYFSGVMVRLMLVLAPAA
  CILSGIALSQAFDVFTRSIKLQLPSLLGHSHVDAGEASSESVVTNDSMKSDKSEDTSKERTSKKSKKKEKEPVEKPPSKSQIKKRLLVLPLETSIIAIVL
  LVLLGAFYVVHSVWAAAEAYSAPSIVLTSHSHDGLHVFDDFREAYAWLSHNTEIDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK
  AAWEIFHSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNCLMYKLSYYRFVETDGKAFDRVR
Full Sequence
Protein Sequence     Length: 779     Download
MAASNAHNGT TTNSIRHAFG NVLAFFILLL IGVLAFSIRL FSVIKYESVI HEFDPYFNYR    60
VTQFLTKNGI YDFWNWFDDR TWYPLGRVIG GTVYPGLTLT AGTLWWVLNS LNIPLSVETV    120
CVFTAPIFSA FASWATYLLT KEVKGAGAGL TAAVLLAMVP SYISRSVAGS YDNEAVAIFA    180
LIFTFYLYIK TLNTGSLFYA TLNSIAYFYM VCSWGGYTFI INLIPMHVLL CIVTGRYSSR    240
LYIAYAPLVV LGTLLAALVP VVGFNAVMTS EHFASFLVFI IIHVVALVHY IKGILSPKMF    300
KVAVALVVSV GLAVCCAMVA VLVALVASSP TKGWSGRSLS LLDPTYASKY IPIIASVSEH    360
QPPTWPSYFM DINVLAFLVP AGIIACFSPL SDASSFVVLY IVTSVYFSGV MVRLMLVLAP    420
AACILSGIAL SQAFDVFTRS IKLQLPSLLG HSHVDAGEAS SESVVTNDSM KSDKSEDTSK    480
ERTSKKSKKK EKEPVEKPPS KSQIKKRLLV LPLETSIIAI VLLVLLGAFY VVHSVWAAAE    540
AYSAPSIVLT SHSHDGLHVF DDFREAYAWL SHNTEIDDKV ASWWDYGYQT TAMANRTVIV    600
DNNTWNNTHI ATVGTAMSSP EKAAWEIFHS LDVKYVLVVF GGLVGYPSDD INKFLWMVRI    660
GGGVFPHIKE PDYLRDGQYR IDSMATPTML NCLMYKLSYY RFVETDGKAF DRVRRTEIGK    720
KYFKLTHFEE VFTTHHWMVR IYKLKPPKNR IRGKIKKSKS KASSKTTSKR KGLKRNPF*     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT31.0e-1025230231+
COG1287COG12871.0e-5125749769+
pfam02516STT39.0e-10622704701+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC79544.10187783511118hypothetical protein OsI_20658 [Oryza sativa Indica Group]
RefSeqNP_001056068.101577816786Os05g0519900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002280521.104577842777PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325019.104575945759predicted protein [Populus trichocarpa]
RefSeqXP_002514244.104577843778oligosaccharyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A053377520266A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.000025627076154A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.000025627076154A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.000025627076154A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
2143
86108
115137
147169
176198
213235
242264
274291
304326
368390
395417
510532
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7788675282237500
HO4763975512137500
HO7969143843967790
HO7788671161102254e-32
HO796914213884081.3
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)