y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g02620.1
FamilyCBM57
Protein PropertiesLength: 1063 Molecular Weight: 119370 Isoelectric Point: 7.969
ChromosomeChromosome/Scaffold: 01 Start: 2146051 End: 2152449
DescriptionDi-glucose binding protein with Kinesin motor domain
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM57612041.9e-32
  MFVNAGGDAFSEAAGGITFLGDTYFDGGNVMRTNEQIVEGGDYPFIYQSARLGSFCYRFANLPPGDYVVDLHFVEIININGPKGMRVFNVYIQDEKVLSE
  LDIYAVVGANKPLQMVDSRVSVKDDGVILIRFESISGSPVVSGI
Full Sequence
Protein Sequence     Length: 1063     Download
MDPTQSNDVQ QYPQTLISEP KDSSMHDANE SLFDSMVCDS SSRLVPTGLT RSGNAEEECF    60
MFVNAGGDAF SEAAGGITFL GDTYFDGGNV MRTNEQIVEG GDYPFIYQSA RLGSFCYRFA    120
NLPPGDYVVD LHFVEIININ GPKGMRVFNV YIQDEKVLSE LDIYAVVGAN KPLQMVDSRV    180
SVKDDGVILI RFESISGSPV VSGICIRRAT KASVPQVTSD YIKCSSCAAQ IEIPSSQMKV    240
MQAKSTAKYK SKIKELTMQC DLKAKECYEA WMSLTAKNEQ LEAVQMELDK VTFKLLTTDQ    300
TVEKQAESLR NISNRYELDK KKWAEAINSL QEKIKLMKSD YSKLSFEAHE CVDSIPELNK    360
MVFAVQELVK QCEDLKVKYS EEMAKRKKLF NEVQEAKGNI RVFCRCRPLN KAEISAGSNT    420
VVDFDAAKEG CLGILTSGST KKSFRFDRVY TPKDDQVDVF ADASSMVISV LDGYNVCIFA    480
YGQTGTGKTF TMEGTQQNRG VNYRTLEHLF KVSKERSETF SYDISVSVIE VYNEQIRDLL    540
ATGQTSKRLE IKQASEGFHH VPGVVEARID NINEVWNVLQ VGNNARAVGS NNVNEHSSRS    600
HCLLCVTVKA KNLLSGESTK SKLWLVDLAG SERLAKTDVQ GERLKEAQNI NRSLSALGDV    660
ISALAAKSSH IPYRNSKLTH LLQDSLGGDS KTLMFVQISP SDQDVGETLS SLNFATRVRG    720
VELGPVKKQI DTSEVQKMKA MLEKARSECR IKDESMRKLE ENLQSLESKA KGKDQIYKNL    780
QEKIQELEGQ IELKRAMQND SEKKISQLSA KLRGKEETCG TLQQKVKELE KKMKEQLQSE    840
SASFQQKVWD LEKKLEDQMQ GSESESAILK DKIKELERKL KEQEQSSMSL LRQQMKELED    900
RYREREQQWQ QTHSFVDAVK AATPDVCKSC MREECPSEIE TGILRCSDSV NRQISQGSSL    960
FKGNDSTHKI SQGSLFKEND STHKIRSKRS NDENNFVMPS SLLHDRRVAR KSDPPKIVRG    1020
VRPTPRPVTA NPAPVSHKRG STSRDQVQGI KERDTKKKIW SR*                      1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01369KISc_KHC_KIF54.0e-104399717324+
cd00106KISc2.0e-121399719329+
smart00129KISc2.0e-134399727336+
pfam00225Kinesin3.0e-138405721326+
cd01366KISc_C_terminal6.0e-177397724330+
Gene Ontology
GO TermDescription
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0007018microtubule-based movement
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN63715.101104611063hypothetical protein [Vitis vinifera]
EMBLCBI40845.107710621979unnamed protein product [Vitis vinifera]
RefSeqXP_002266404.1018231847PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002266404.11e-218241062759982PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002532381.101984037857ATP binding protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2h58_A03967232330A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3h4s_A03867751383A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_C03947421347A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_A03947421347A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cnz_B03947421347A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL9216582584897460
DV9908453024537500
EL4429302664857480
ES8650562874667480
EH1942273375328680
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00213.1Aquca_015_00213.2
Arabidopsis thalianaAT2G22610.1AT2G22610.2
Brassica rapaBra038507Bra016076
Carica papayaevm.model.supercontig_229.5evm.model.supercontig_21.41
Capsella rubellaCarubv10022542mCarubv10022541m
Citrus clementinaCiclev10000147mCiclev10024772m
Citrus sinensisorange1.1g037169morange1.1g001679m
Fragaria vescamrna20704.1-v1.0-hybridmrna26561.1-v1.0-hybrid
Glycine maxGlyma09g33340.2
Gossypium raimondiiGorai.008G093800.1Gorai.009G228400.1Gorai.002G032500.3Gorai.002G032500.2Gorai.002G032500.1
Linum usitatissimumLus10005582Lus10035954Lus10025708Lus10013714
Malus domesticaMDP0000317970
Manihot esculentacassava4.1_032042mcassava4.1_000724m
Medicago truncatulaAC174330_12.1AC146711_18.1AC146711_37.1Medtr5g031470.1
Mimulus guttatusmgv1a000533m
Physcomitrella patensPp1s9_137V6.1Pp1s403_54V6.1
Phaseolus vulgarisPhvul.002G145000.1
Picea abiesMA_180169g0010
Populus trichocarpaPotri.002G110600.2Potri.011G140000.1Potri.001G436200.1Potri.001G436200.2Potri.001G436200.4
Potri.002G110600.1
Prunus persicappa014706mppa015110m
Ricinus communis29591.m00013929235.m00023229596.m000713
Selaginella moellendorffii13900998850
Vitis viniferaGSVIVT01003948001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny