y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g05991.1
FamilyGH17
Protein PropertiesLength: 203 Molecular Weight: 22367.9 Isoelectric Point: 7.7426
ChromosomeChromosome/Scaffold: 01 Start: 5815182 End: 5815856
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1741880
  MSHLVNFLMHQKITHIGLYDPNPDILRALSGTHIHVTISVPNNQLLAIASSNTTATSWIRRNVAAYHPSTRIAAVSLGDEVLSTLPSVAPLLLLALCSLH
  AALVYSNLHNDVFVSTPHSASVILNPFPPSQGFFNQTLETFILPLLHFLSQTNSPLMLNLYPYYVFMQNRNLVPLENTLFKWCHI
Full Sequence
Protein Sequence     Length: 203     Download
MASMSHLVNF LMHQKITHIG LYDPNPDILR ALSGTHIHVT ISVPNNQLLA IASSNTTATS    60
WIRRNVAAYH PSTRIAAVSL GDEVLSTLPS VAPLLLLALC SLHAALVYSN LHNDVFVSTP    120
HSASVILNPF PPSQGFFNQT LETFILPLLH FLSQTNSPLM LNLYPYYVFM QNRNLVPLEN    180
TLFKWCHIIV TNGITCISAQ QQ*                                            240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_178.0e-323184182+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC17632.10318457238Similar to glucan endo-1,3-beta-D-glucosidase precursor gb
RefSeqNP_172647.20318457238catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqXP_002316541.1031842183predicted protein [Populus trichocarpa]
RefSeqXP_002332610.1031842183predicted protein [Populus trichocarpa]
RefSeqXP_002518468.10318463244Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A3e-31519316203A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D2e-28419316207A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C2e-28419316207A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B2e-28419316207A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A2e-28419316207A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CF23034718411840
EY69328318231840
DN79570118231840
GE48421618051840
EH75841118051840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00065.2.25.344Aquca_091_00065.1.25.344Aquca_004_00728.2.30.350Aquca_004_00728.1.30.350Aquca_005_00012.3.49.368
Aquca_005_00012.2.49.368Aquca_005_00012.1.49.368Aquca_009_00463.1.26.346
Arabidopsis lyrata918818.26.346894267.29.348484077.23.342879428.44.363478745.26.346
913572.27.345
Arabidopsis thalianaAT5G56590.1.26.346AT2G01630.2AT2G01630.1.23.342AT3G13560.3.26.346AT3G13560.2.26.346
AT3G13560.1.26.346AT1G66250.1.32.350AT1G11820.2.44.363AT1G11820.1AT4G29360.2.27.345
AT4G29360.1.27.345
Brachypodium distachyonBradi1g69610.1.25.345Bradi1g23640.1.34.355Bradi1g26510.1.46.373Bradi2g49330.2.27.344Bradi2g49330.1.27.344
Brassica rapaBra002805.12.332Bra027421.26.345Bra026644.23.342Bra039757.32.351Bra016812.48.367
Bra010330.16.334Bra011100.28.316
Carica papayaevm.model.supercontig_116.58.23.342evm.model.supercontig_2.222.14.333evm.model.supercontig_152.27.47.366
Capsella rubellaCarubv10026261m.28.348Carubv10019942m.166.485Carubv10019481m.23.342Carubv10013514m.26.346Carubv10007158m.27.345
Citrus clementinaCiclev10011549m.23.342Ciclev10014990m.24.343Ciclev10015028m.26.347Ciclev10015027m.26.347
Citrus sinensisorange1.1g010931m.23.342orange1.1g010833m.24.343orange1.1g010394m.31.350orange1.1g011132m.26.347orange1.1g011131m.26.347
Cucumis sativusCucsa.006230.1.30.349Cucsa.029930.3.23.342Cucsa.029930.1.23.342Cucsa.085740.1.42.361Cucsa.355790.4.25.345
Cucsa.355790.3.25.345Cucsa.355790.2.25.345Cucsa.355790.1.25.345Cucsa.153140.1.29.348
Eucalyptus grandisEucgr.F02860.2.27.346Eucgr.F02860.1.27.346Eucgr.G02118.1.24.343Eucgr.D01339.2.43.362Eucgr.D01339.1.43.362
Eucgr.E04042.1.55.374Eucgr.B03614.1.26.346
Fragaria vescamrna30530.1-v1.0-hybrid.32.351mrna19637.1-v1.0-hybrid.233.552
Glycine maxGlyma02g07730.1.23.342Glyma14g39510.3.75.394Glyma14g39510.2.75.394Glyma11g33650.1.23.342Glyma02g41190.1.24.343
Glyma05g34930.2.22.341Glyma18g04560.1.23.342Glyma08g04780.2.27.346Glyma16g26800.5.32.292Glyma16g26800.4.32.292
Glyma16g26800.3.32.292Glyma07g39140.5.43.362Glyma07g39140.4.43.362Glyma07g39140.3.43.362Glyma17g01601.2.66.385
Glyma17g01601.1.66.385Glyma14g16630.2.29.350Glyma17g29820.4.26.347Glyma17g29820.3.26.347Glyma17g29820.2.26.347
Glyma08g12020.1.26.347Glyma05g28870.1.26.347Glyma16g26800.7.33.138Glyma16g26800.7.33.138Glyma16g26800.6.33.138
Glyma16g26800.6.33.138
Gossypium raimondiiGorai.001G204900.2.125.444Gorai.001G204900.1.125.444Gorai.005G159100.2.23.342Gorai.005G159100.1.23.342Gorai.002G174100.2.23.342
Gorai.002G174100.1.23.342Gorai.004G064200.1.23.342Gorai.009G179400.3.46.365Gorai.009G179400.2.46.365Gorai.009G179400.1.46.365
Gorai.004G094500.1.25.345Gorai.010G126400.5.26.347Gorai.010G126400.2.26.347Gorai.010G126400.1.26.347
Linum usitatissimumLus10013465.24.343Lus10002295.34.354Lus10004044.34.354Lus10031456.44.370Lus10039179.46.365
Lus10034987.31.294
Malus domesticaMDP0000251002.284.604MDP0000271262.26.346MDP0000319911.279.599MDP0000120761.26.346
Manihot esculentacassava4.1_005970m.32.351cassava4.1_006180m.23.342cassava4.1_021465m.50.369cassava4.1_030523m.24.341cassava4.1_006189m.26.346
Medicago truncatulaMedtr5g078200.1.23.342Medtr3g065460.1.24.344Medtr4g132280.1.45.364Medtr8g085720.1.26.346Medtr3g083580.1.26.348
Medtr8g102340.1.54.312Medtr6g090590.1.61.310
Mimulus guttatusmgv1a004953m.31.350mgv1a005128m.23.342mgv1a006342m.31.350mgv1a004989m.25.345mgv1a005031m.28.346
Oryza sativaLOC_Os03g12140.1.26.346LOC_Os07g38930.5.31.352LOC_Os07g38930.4.31.352LOC_Os07g38930.3.31.352LOC_Os07g38930.2.31.352
LOC_Os07g38930.1.31.352LOC_Os07g32600.2.45.374LOC_Os07g32600.1.45.374LOC_Os01g53750.1.23.341
Panicum virgatumPavirv00023750m.26.346Pavirv00010764m.25.346Pavirv00062581m.25.346Pavirv00014937m.41.373Pavirv00068281m.41.373
Pavirv00025012mPavirv00058553m.13.331
Physcomitrella patensPp1s98_31V6.1.28.346Pp1s1_72V6.2.26.344Pp1s1_72V6.1.26.344Pp1s138_47V6.2.38.358Pp1s138_47V6.1.38.358
Pp1s85_128V6.1.32.350
Phaseolus vulgarisPhvul.001G230000.1.23.343Phvul.004G077000.1.22.341Phvul.008G236700.1.23.342Phvul.002G319500.2Phvul.002G319500.1.25.344
Phvul.003G079900.1.44.363Phvul.001G056400.1.29.350Phvul.002G236300.2.26.347Phvul.002G236300.1.26.347Phvul.006G149100.2.35.354
Phvul.006G149100.1.35.354
Picea abiesMA_10436589g0010.77.396MA_9241891g0010.84.403
Populus trichocarpaPotri.004G086400.3.17.336Potri.004G086400.1.31.350Potri.017G130200.2.31.350Potri.017G130200.1.31.350Potri.010G108500.1.23.342
Potri.008G133200.1.23.342Potri.004G010500.2.45.364Potri.004G010500.1.45.364Potri.011G006100.1.45.364Potri.003G218500.4.22.341
Potri.003G218500.3Potri.003G218500.2.22.341Potri.003G218500.1.22.341Potri.001G006500.2.22.341Potri.001G006500.1.22.341
Potri.018G068600.2Potri.018G068600.1.27.345
Prunus persicappa004534m.31.350ppa003984m.52.371ppa004732m.26.346
Ricinus communis29692.m000518.23.34229005.m000260.34.35329842.m003579.50.369
Setaria italicaSi029628m.25.346Si029448m.39.370Si000583m.196.514Si000582m.196.514
Selaginella moellendorffii442025.18.33675479.10.330402967.20.337
Sorghum bicolorSb01g042560.1.26.346Sb02g037380.1.25.346Sb03g034100.1.27.345
Thellungiella halophilaThhalv10013309m.26.346Thhalv10020572m.23.342Thhalv10020571m.23.342Thhalv10020570m.23.342Thhalv10004013m.39.358
Thhalv10018427m.35.354Thhalv10006713m.49.368Thhalv10024870m.27.345
Vitis viniferaGSVIVT01030716001.22.341GSVIVT01011682001.23.342GSVIVT01012711001.47.366GSVIVT01015282001.26.343
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)