y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g22406.1
FamilyCBM57
Protein PropertiesLength: 643 Molecular Weight: 70444 Isoelectric Point: 6.8254
ChromosomeChromosome/Scaffold: 01 Start: 28104832 End: 28117466
DescriptionDi-glucose binding protein with Leucine-rich repeat domain
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572283763.7e-22
  SDRFGRSWQSDSDFRTGRSKVRAVSTRSGISGTEQKPNYFPEKLYQSAAMTAVTAEEGDGVLEYELSVDAKLDYLVWLHFAEIEGRVRRVGERVFDVYIN
  NDNLTRIDIYKQVGGFAAFTWHHTVKNLSSSVLSVKLVGVVGAPLICGI
Full Sequence
Protein Sequence     Length: 643     Download
MSLFHTLTLL IFLFVILFTT STTTSTPLPL PTPSFPSGLS YHIDCGSPTN STDQFNTTWL    60
SDRYFSGGAT GIVSEPLRFR HGHEKTLRFF PISSGKKNCY TVPNLPPSRY LLRTFVVYDN    120
YDGRSHPPSF DVAVAATVVF SWRSPWPQSL ARNGAYADLF ATIASSEALI CFYSFATDPP    180
VVSSIELFAA DPASYDAAAI GKNDIVLVNY GRLSCGSNQW GPGFSNDSDR FGRSWQSDSD    240
FRTGRSKVRA VSTRSGISGT EQKPNYFPEK LYQSAAMTAV TAEEGDGVLE YELSVDAKLD    300
YLVWLHFAEI EGRVRRVGER VFDVYINNDN LTRIDIYKQV GGFAAFTWHH TVKNLSSSVL    360
SVKLVGVVGA PLICGIENYA LVPSDPSTVP EQVVAMKALK DSFRVPERMG WNGDPCAPTN    420
WDAWEGVTCR TSKNSTTLVI SQIDLGSQGL KGSISDQISL LSDLVSLNLS SNLLVGEIPS    480
GLGQKSLIHL DLSNNQLTGP IPDSIASSSL QLVLLNGNLL EGRVPEQLYS IGVHGGAIDL    540
SGNKGLCGVP SLPDCPMFWE NGKLSTQGKI AIGLSCLFVF CVILLLVYIY IRRRRNDYDF    600
ALPHELTSLA AKRNRYQRQK SLMVLEMESQ HAKGLPSHFT TQ*                      660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11721Malectin0.0084111381+
PLN00113PLN001130.00141950292+
pfam11721Malectin8.0e-10212343138+
pfam12819Malectin_like3.0e-4443347320+
PLN03150PLN031504.0e-8443575548+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG50525.103461523550AC084221_7 hypothetical protein [Arabidopsis thaliana]
RefSeqNP_564237.203463723622leucine-rich repeat protein-related [Arabidopsis thaliana]
RefSeqXP_002281668.103563725621PREDICTED: similar to leucine-rich repeat protein-related [Vitis vinifera]
RefSeqXP_002457393.104063529625hypothetical protein SORBIDRAFT_03g006620 [Sorghum bicolor]
RefSeqXP_002524408.103661319591serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hq1_A0.000000339552831156B Chain B, Crystal Structure Of Recombinant Foot-and-mouth-disease Virus A22- H2093c Empty Capsid
PDB3rgz_A0.00002439525224311B Chain B, Crystal Structure Of Recombinant Foot-and-mouth-disease Virus A22- H2093c Empty Capsid
PDB3rgz_A0.00004443503661722B Chain B, Crystal Structure Of Recombinant Foot-and-mouth-disease Virus A22- H2093c Empty Capsid
Transmembrane Domains
StartEnd
729
570592
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9812052242294520
BX839191305413430
DY286117308413450
BX840772272413100
DT558701271413100
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma20g32720.1Glyma15g08350.4Glyma15g08350.3
Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)