y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g26750.2
FamilyAA1
Protein PropertiesLength: 567 Molecular Weight: 62332.1 Isoelectric Point: 6.3051
ChromosomeChromosome/Scaffold: 01 Start: 35573029 End: 35581615
Descriptionlaccase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1245250
  AVVEHTFNIGNLTVSRLCNEEVITTVNGSLPGPTIYVEEGDTLVVHANNNSPYNITLHWHGIFQILTAWADGPESVTQCPIRPGGKYTYRFNITGQEGTL
  WWHSHSSFLRATVYGALIIRPRRGNSHPFPSVYQEVPILLGEWWNGNVVDVENNAIETGIGPNLSDAYTINGLPGDTYNCSQNQTYQLQVKHGETYLLRI
  INAALNAQHFFKIANHTFTVVAIDASYTQPYNTDVIILAPGQTVDAIITTNQTLGSYYMAFTPYHSAPGVSINNNITRGVVIYENATSASPVMPDLPAQT
  DTPTAHKFYTNITGLAGGPHWVPVPLNVDQHMLITFGIGLDHCPELDPEGCGGRNFRLSASMNNESFVLPKGLSMMEAFFRNVSGVYTRDFPDNPPFVFN
  YTDPTLETNGTDIAFAPKSTKVKPLTFNSTVQVVLQNTAILARENHPIHLHSFNFHVLAQGFGNYDSNVDESKFNLDNPQIRNTISVPVGGWAVIRFQAN
  NP
Full Sequence
Protein Sequence     Length: 567     Download
MKRLVFSLAW AFALLLACSL VSGAVVEHTF NIGNLTVSRL CNEEVITTVN GSLPGPTIYV    60
EEGDTLVVHA NNNSPYNITL HWHGIFQILT AWADGPESVT QCPIRPGGKY TYRFNITGQE    120
GTLWWHSHSS FLRATVYGAL IIRPRRGNSH PFPSVYQEVP ILLGEWWNGN VVDVENNAIE    180
TGIGPNLSDA YTINGLPGDT YNCSQNQTYQ LQVKHGETYL LRIINAALNA QHFFKIANHT    240
FTVVAIDASY TQPYNTDVII LAPGQTVDAI ITTNQTLGSY YMAFTPYHSA PGVSINNNIT    300
RGVVIYENAT SASPVMPDLP AQTDTPTAHK FYTNITGLAG GPHWVPVPLN VDQHMLITFG    360
IGLDHCPELD PEGCGGRNFR LSASMNNESF VLPKGLSMME AFFRNVSGVY TRDFPDNPPF    420
VFNYTDPTLE TNGTDIAFAP KSTKVKPLTF NSTVQVVLQN TAILARENHP IHLHSFNFHV    480
LAQGFGNYDS NVDESKFNLD NPQIRNTISV PVGGWAVIRF QANNPEGSVF GENSLIELAS    540
WIRGSSWGNS SMEMARHGPR GGFRHS*                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_32.0e-4531147119+
PLN02191PLN021913.0e-5022525534+
PLN02604PLN026041.0e-5741525512+
TIGR03388ascorbase1.0e-6825525533+
TIGR03389laccase028525499+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACB10229.1015251529laccase [Solanum lycopersicum]
RefSeqXP_002276415.101952518522PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308196.1015251519laccase 110a [Populus trichocarpa]
RefSeqXP_002333273.101952518525predicted protein [Populus trichocarpa]
RefSeqXP_002527888.10305252497laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B04152519500A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1asq_A04152519500A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1asp_B04152519500A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1asp_A04152519500A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1aso_B04152519500A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR831315233212530
HO7610012631524090
BQ453624198972940
HO797675455765250
HO761001161381537.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00804.1Aquca_009_00807.1Aquca_009_00807.2
Arabidopsis lyrata478237472269486975
Arabidopsis thalianaAT3G09220.1AT5G01040.1AT5G01050.1
Brachypodium distachyonBradi4g39330.1Bradi2g55050.1Bradi2g55060.1Bradi4g11827.1Bradi4g11850.1
Bradi3g45190.1Bradi1g10567.1Bradi3g22317.1Bradi4g11780.1Bradi4g11770.1
Bradi4g11840.1Bradi3g02290.1Bradi3g02300.1
Brassica rapaBra029753Bra028885Bra005699
Capsella rubellaCarubv10016347mCarubv10000548m
Glycine maxGlyma01g26750.1Glyma03g15800.5Glyma03g15805.1Glyma07g17170.1Glyma18g41886.1
Glyma18g41860.1Glyma07g17150.1Glyma18g41870.1
Malus domesticaMDP0000291183
Manihot esculentacassava4.1_006971m
Oryza sativaLOC_Os01g63200.1LOC_Os01g63190.1LOC_Os11g42200.1LOC_Os11g42220.1LOC_Os11g16260.1
LOC_Os10g20610.1
Panicum virgatumPavirv00040765mPavirv00049024mPavirv00038281mPavirv00007769mPavirv00063349m
Pavirv00062920mPavirv00053056mPavirv00047982mPavirv00069158mPavirv00051794m
Pavirv00019186mPavirv00057102mPavirv00039741mPavirv00033330mPavirv00023383m
Pavirv00050058mPavirv00043455mPavirv00033589mPavirv00032842mPavirv00018047m
Pavirv00032841mPavirv00054602mPavirv00028624mPavirv00051105mPavirv00056353m
Pavirv00054858mPavirv00054859m
Phaseolus vulgarisPhvul.010G005900.1Phvul.008G112100.1
Setaria italicaSi021601mSi020688mSi027309mSi021573mSi021628m
Si004353mSi000613mSi026121mSi028303mSi027928m
Si009653mSi026113mSi028115mSi027394mSi026118m
Si026123mSi026150mSi026109mSi028248mSi027660m
Si026140mSi027267mSi026136mSi027586mSi026159m
Si026153mSi026117mSi028198mSi026161mSi026162m
Si008101mSi026299mSi026376mSi026137mSi024846m
Si001570mSi001277mSi001174mSi027990m.20.264Si027990m.20.264
Si027990m.273.533Si027990m.273.533
Sorghum bicolorSb08g011530.1Sb03g039960.1Sb03g039980.1Sb03g039970.1Sb05g026630.1
Sb03g009410.1Sb05g025570.1Sb02g000300.1
Thellungiella halophilaThhalv10020392mThhalv10020388mThhalv10013097mThhalv10013058mThhalv10015329m
Zea maysAC234190.1_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)