y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g26800.1
FamilyAA1
Protein PropertiesLength: 228 Molecular Weight: 25654.1 Isoelectric Point: 8.4607
ChromosomeChromosome/Scaffold: 01 Start: 35606473 End: 35610217
Descriptionlaccase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA162020
  AAVVEHTFNVEDISVQRLCRQQPITAVNGTLQGPTINAREGDTIVVYVFNKSPYNLTLHWHGIIQFLTPWSDGPEFVTQCPIPSGGSYTYKFNLTGQEGT
  LWWHAHSSFLRATVYGALLIRPRLGHSYPFPKVYQEVPIIIGEWWNANVVEVEHNATESQTAPIPSAAYTINGLPGYFCNCSESRRFRSIFGLRWCT
Full Sequence
Protein Sequence     Length: 228     Download
SSLAHAAVVE HTFNVEDISV QRLCRQQPIT AVNGTLQGPT INAREGDTIV VYVFNKSPYN    60
LTLHWHGIIQ FLTPWSDGPE FVTQCPIPSG GSYTYKFNLT GQEGTLWWHA HSSFLRATVY    120
GALLIRPRLG HSYPFPKVYQ EVPIIIGEWW NANVVEVEHN ATESQTAPIP SAAYTINGLP    180
GYFCNCSESR RFRSIFGLRW CTSIVQEYTV KLGRFSSLEN KRYAKKI*                 240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02604PLN026044.0e-2624180159+
PLN02191PLN021913.0e-284202203+
TIGR03388ascorbase7.0e-318195198+
pfam07732Cu-oxidase_32.0e-5014128117+
TIGR03389laccase6.0e-866193188+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI30455.10122717235unnamed protein product [Vitis vinifera]
RefSeqXP_002276415.10122717235PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308196.10119317209laccase 110a [Populus trichocarpa]
RefSeqXP_002322939.10119317209predicted protein [Populus trichocarpa]
RefSeqXP_002333273.10119317209predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B3e-212415819153A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1asq_A3e-212415819153A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1asp_B3e-212415819153A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1asp_A3e-212415819153A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1aso_B3e-212415819153A Chain A, Raphanus Sativus Anionic Peroxidase.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FK00259819311930
GR85695518821890
BF64869318381900
GR83131519221930
CK27258920812060
Orthologous Group
SpeciesID
Oryza sativaLOC_Os01g63190.3
Picea abiesMA_73829g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny