y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g29378.2
FamilyCBM57
Protein PropertiesLength: 968 Molecular Weight: 107445 Isoelectric Point: 6.8669
ChromosomeChromosome/Scaffold: 01 Start: 39478264 End: 39516299
DescriptionLeucine-rich repeat transmembrane protein kinase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM573975623.9e-30
  HINCGGNLVTDGKKTYDDDTGETTGPASFHNDRGKNWALINNGHLFDTDRVNYYNVTNSTKLVMENVELYMNARVSPTSLTYYGFCLGNGNYTVKLHFAE
  IMFTDDKTYSSLGRRVFDIYIQRNLVAKDFNIAKEAGGVGKAVIKNFTVVVTSNALEIRLYWAGKG
Full Sequence
Protein Sequence     Length: 968     Download
MMGVFSGFPL LFLLPFCFAS LAFGATLPED EVQALRDIAH TIGKKNWNYS VDPCTGKSNW    60
NSSEKNVVTC NCSFVNHTCH VVSIILKEQN LSGIISTDLV RLSYLQQIDF TRNYLNGTIP    120
RQLGTLNLVN ISFIGNRLTG PIPKELGNIT TLKILKLEFN QLSGSLPLEL GNLAQIEKLH    180
LTSNNFTGEL PATLARLTTL KELRIGDNQF SGAIPNFIQS WINLEKLIMH GSGLSGPIPS    240
GISILRNLTD LRVTDLNGSD SRFPQLNNMT NLLTLIFRSC NIIGSLPENL VKLTNLEILD    300
VSYNKLTGPI PSIFGDLPHL NMLFLEGNHL TGSLPRLIDR PHYVDLSYNN LSIGNNIEEL    360
QCQPGTVNLF ASFSNGNSLG NVSCLSNIPC KTSYSLHINC GGNLVTDGKK TYDDDTGETT    420
GPASFHNDRG KNWALINNGH LFDTDRVNYY NVTNSTKLVM ENVELYMNAR VSPTSLTYYG    480
FCLGNGNYTV KLHFAEIMFT DDKTYSSLGR RVFDIYIQRN LVAKDFNIAK EAGGVGKAVI    540
KNFTVVVTSN ALEIRLYWAG KGTTSIPFRS VYGPLISAIS VDPNFIPPSE SGSSSISIIR    600
VVVAVVVAGA IIILIFGILW WKRFLGWERS VARELKGFES QTSLFTLRQI KAATNNFDKS    660
LKIGEGGFGL VYKGVLSDGT VVAVKQLSTR SRQGSREFVN EIGLISALQH PCLVKLYGCC    720
MEEDQLLLIY EYMENNSLAH ALFAKNDESE KCQLRLDWQT RHRICVGIAK GLAYLHEESK    780
LKIVHRDIKA NNVLLDKDLN PKISDFGLAK LNDEDKTHLS TRIAGTYGMS NTISQPTEEC    840
FSLIDRVHLL KENGNLMEIV DKRLGEHFNK TEAMMMINVA LLCTKVSLAL RPTMSLVVSM    900
LEGRTRIQEV VLDKREVLDD DKFEIMQQYY QHRGENNIIE SQNLSDPTGE SSKLFADTSS    960
SGEQIES*                                                             1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001133.0e-2481352277+
PLN00113PLN001133.0e-4152375353+
smart00221STYKc2.0e-41662816161+
smart00219TyrKc5.0e-42662818163+
pfam11721Malectin5.0e-57394579192+
Gene Ontology
GO TermDescription
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0006468protein phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAU10526.102493226966putative receptor-like protein kinase 2 [Glycine max]
EMBLCBI20124.1032949621011unnamed protein product [Vitis vinifera]
RefSeqXP_002283578.102794928959PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002283596.1031949641011PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002524514.1059423973ATP binding protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ulz_A064190316308B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3uim_A064190316308A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation
PDB3tl8_H064190324316B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3tl8_G064190324316B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3tl8_D064190324316B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
Transmembrane Domains
StartEnd
527
598620
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7977603964338280
CO9835791987719680
BG0447882132724840
HO7985713085218280
BG04478887811670.11
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_039_00020.3Aquca_039_00020.2Aquca_039_00020.1Aquca_039_00021.1Aquca_039_00015.1
Aquca_039_00022.1Aquca_039_00018.1Aquca_039_00016.1Aquca_039_00019.1Aquca_055_00015.1
Aquca_012_00201.2Aquca_012_00201.1Aquca_039_00012.3Aquca_039_00012.2Aquca_039_00012.1
Arabidopsis lyrata474473474471881264473178866958
885138473176470791478899
Arabidopsis thalianaAT1G53440.1AT1G53430.2AT1G53430.1AT1G29720.1AT1G53420.1
AT1G29740.1AT1G07650.2AT1G07650.1AT1G29730.1AT1G29750.2
AT1G29750.1AT3G14840.2
Brachypodium distachyonBradi3g08917.2Bradi3g08917.1Bradi4g28367.1
Brassica rapaBra038124Bra010815Bra032332Bra030168Bra018693
Bra030169Bra027306Bra032331Bra030170Bra001566
Bra027307Bra030167Bra030174Bra027302Bra021579
Bra030161Bra030166Bra001567Bra010817Bra032333
Bra010816
Carica papayaevm.TU.contig_37590.1evm.model.supercontig_77.40evm.model.supercontig_77.35evm.model.supercontig_124.19evm.model.supercontig_124.16
Capsella rubellaCarubv10011641mCarubv10012061mCarubv10012394mCarubv10006720mCarubv10008178m
Carubv10008435mCarubv10011126mCarubv10012882mCarubv10008187mCarubv10011709m
Carubv10008366mCarubv10021813mCarubv10016637mCarubv10011128m
Citrus clementinaCiclev10018721mCiclev10018686mCiclev10024314mCiclev10018908mCiclev10019246m
Ciclev10018771mCiclev10014830mCiclev10014765mCiclev10014427mCiclev10014395m
Ciclev10014258mCiclev10014129mCiclev10014126mCiclev10014125mCiclev10024045m
Ciclev10023853mCiclev10020672mCiclev10020826m
Citrus sinensisorange1.1g004275morange1.1g001768morange1.1g001767morange1.1g043333morange1.1g045177m
orange1.1g040908morange1.1g006906morange1.1g005361morange1.1g003737morange1.1g003134m
orange1.1g002899morange1.1g002566morange1.1g046961morange1.1g023918morange1.1g045835m
orange1.1g040398morange1.1g027337m
Cucumis sativusCucsa.273550.2Cucsa.273550.1Cucsa.057870.1Cucsa.057860.1Cucsa.212760.1
Cucsa.185230.1Cucsa.057940.1Cucsa.057890.1Cucsa.057880.1
Eucalyptus grandisEucgr.F01301.1Eucgr.F01305.3Eucgr.F01305.2Eucgr.F01305.1Eucgr.F01302.1
Eucgr.F01306.1Eucgr.F04179.1Eucgr.F04177.1Eucgr.F04178.1Eucgr.B00978.1
Eucgr.B00894.1Eucgr.B00963.1Eucgr.B00960.1Eucgr.B00972.1Eucgr.F01359.1
Eucgr.K01762.1Eucgr.K01777.2Eucgr.K01777.1Eucgr.K01737.1Eucgr.F01312.2
Eucgr.F01312.1Eucgr.E04067.1Eucgr.F01308.1Eucgr.F04180.1Eucgr.K01781.2
Eucgr.K01781.1Eucgr.G01055.1Eucgr.K01793.1Eucgr.F01310.1Eucgr.F01353.1
Eucgr.A01951.2Eucgr.K01759.1Eucgr.K01987.1Eucgr.K01985.1Eucgr.F01307.1
Eucgr.K02000.1Eucgr.A01951.1Eucgr.F01314.1Eucgr.K01743.1Eucgr.F01361.2
Eucgr.F01361.1Eucgr.F01357.1Eucgr.F01330.1Eucgr.K01724.1Eucgr.K01771.1
Eucgr.F01362.1Eucgr.F01313.1Eucgr.D00419.1Eucgr.D00415.1Eucgr.E02844.1
Eucgr.E02839.1Eucgr.E02843.1Eucgr.E02842.1Eucgr.D00417.2Eucgr.D00417.1
Fragaria vescamrna27319.1-v1.0-hybridmrna27321.1-v1.0-hybridmrna27328.1-v1.0-hybridmrna27326.1-v1.0-hybridmrna19789.1-v1.0-hybrid
mrna27330.1-v1.0-hybridmrna34059.1-v1.0-hybridmrna27329.1-v1.0-hybridmrna24842.1-v1.0-hybrid.782.946mrna24842.1-v1.0-hybrid.782.946
mrna24842.1-v1.0-hybrid.782.946mrna28915.1-v1.0-hybridmrna23790.1-v1.0-hybridmrna24842.1-v1.0-hybrid.324.449mrna24842.1-v1.0-hybrid.324.449
mrna24842.1-v1.0-hybrid.324.449
Glycine maxGlyma12g25460.2Glyma06g31630.2Glyma13g34140.3Glyma13g34140.2Glyma12g36090.1
Glyma12g36161.2Glyma12g36161.1Glyma12g36190.1Glyma13g34090.2Glyma02g45800.1
Glyma12g36170.2Glyma13g34100.1Glyma14g02990.1Glyma13g34066.5Glyma13g34066.4
Glyma13g34066.3Glyma13g34066.2Glyma13g34066.1Glyma01g29330.2Glyma01g29378.1
Glyma01g29362.2Glyma01g29362.1Glyma13g29640.1Glyma05g29530.2
Gossypium raimondiiGorai.009G363600.1Gorai.002G049000.1Gorai.007G329800.1Gorai.007G330600.1Gorai.007G330300.1
Gorai.007G330700.1Gorai.009G159600.2Gorai.009G159600.1Gorai.007G330500.2Gorai.007G330500.1
Gorai.009G159500.2Gorai.009G159500.1Gorai.009G159400.2Gorai.009G159400.1Gorai.002G048900.2
Gorai.002G048900.1Gorai.002G048600.1Gorai.002G048300.2Gorai.002G048300.1Gorai.006G003800.1
Gorai.010G162700.2Gorai.010G162700.1Gorai.009G159800.6Gorai.002G048800.2Gorai.002G048800.1
Gorai.007G330000.2Gorai.007G330000.1Gorai.010G162800.6Gorai.010G162800.5Gorai.010G162800.4
Gorai.010G162800.3Gorai.010G162800.2Gorai.010G162800.1Gorai.010G163000.1Gorai.009G159800.5
Gorai.009G159800.4Gorai.009G159800.3Gorai.009G159800.2Gorai.009G159800.1
Linum usitatissimumLus10005550Lus10038153Lus10042505Lus10010951Lus10031374
Lus10005418Lus10015239
Malus domesticaMDP0000292097MDP0000263999MDP0000280824MDP0000164991MDP0000314346
MDP0000158644MDP0000196032MDP0000232699MDP0000554411MDP0000204873
MDP0000228140MDP0000195070MDP0000304817MDP0000305229MDP0000197297
MDP0000222736MDP0000228029MDP0000212352MDP0000163412MDP0000207132
MDP0000199384MDP0000845743
Manihot esculentacassava4.1_002090mcassava4.1_000803mcassava4.1_031464mcassava4.1_001160mcassava4.1_001028m
cassava4.1_001039mcassava4.1_000765mcassava4.1_003034mcassava4.1_001048mcassava4.1_000840m
cassava4.1_024552mcassava4.1_025472mcassava4.1_025223mcassava4.1_030745mcassava4.1_004308m
cassava4.1_002534mcassava4.1_031454m
Medicago truncatulaMedtr8g058250.1Medtr2g075250.1Medtr2g075060.1Medtr2g075140.1Medtr2g074980.1
Medtr2g074990.1Medtr2g074840.1Medtr5g083910.1Medtr5g091950.1Medtr2g074880.1
Medtr8g057890.1Medtr8g057900.1Medtr8g087740.1
Mimulus guttatusmgv1a026921mmgv1a000913mmgv1a025582m
Oryza sativaLOC_Os09g17630.1LOC_Os02g13850.1
Panicum virgatumPavirv00034171m
Phaseolus vulgarisPhvul.005G079100.1Phvul.011G167800.1Phvul.005G077900.1Phvul.005G077600.1Phvul.005G077400.1
Phvul.005G078900.1Phvul.005G078500.1Phvul.011G067400.1Phvul.005G078400.1Phvul.008G264400.1
Phvul.005G078100.1Phvul.005G078600.1Phvul.006G170500.2Phvul.006G170500.1Phvul.002G242600.1
Populus trichocarpaPotri.003G025800.1Potri.001G385600.1Potri.001G385900.3Potri.001G385900.2Potri.001G385900.1
Potri.003G026300.1Potri.011G106400.1Potri.001G386300.3Potri.001G386300.2Potri.001G386300.1
Potri.003G025600.1Potri.001G385400.1Potri.001G385300.2Potri.001G385300.1Potri.001G386500.1
Potri.019G009700.1Potri.019G006000.1Potri.019G009500.1Potri.019G009800.2Potri.019G009800.1
Potri.019G005700.1Potri.019G008900.1Potri.019G005900.6Potri.019G005900.5Potri.019G005900.4
Potri.019G005900.3Potri.019G005900.2Potri.019G005900.1Potri.001G385200.3Potri.001G385200.2
Potri.001G385200.1Potri.019G005300.2Potri.019G005300.1Potri.016G061500.4Potri.016G061500.3
Potri.016G061500.2Potri.016G061500.1Potri.019G007900.1Potri.001G384700.1Potri.019G005000.2
Potri.019G005000.1Potri.T033300.1Potri.T010200.1Potri.001G308600.2Potri.001G308600.1
Potri.004G135500.2Potri.004G135500.1Potri.011G075300.1Potri.T008400.1Potri.T032500.4
Potri.T032500.3Potri.T032500.2Potri.T032500.1Potri.T008300.1Potri.011G073700.2
Potri.011G073700.1Potri.019G004800.1Potri.019G004600.1Potri.019G005200.2Potri.019G005200.1
Potri.001G385500.1Potri.T007800.1Potri.T009500.1Potri.T009000.1Potri.T009600.1
Potri.T032700.6Potri.T032700.5Potri.T032700.4Potri.T032700.3Potri.T032700.2
Potri.T032700.1Potri.011G072800.1Potri.T009900.1Potri.T072700.1Potri.011G072300.1
Potri.004G063200.5Potri.004G063200.4Potri.004G063200.3Potri.004G063200.2Potri.004G063200.1
Potri.T032400.2Potri.T032400.1Potri.011G072600.1Potri.011G075400.3Potri.011G075400.2
Potri.011G075400.1Potri.004G063500.1Potri.T009100.1Potri.T033000.1Potri.T032200.2
Potri.T032200.1Potri.T008600.2Potri.T008600.1Potri.004G063500.2Potri.016G012100.1
Potri.016G011200.5Potri.016G011200.4Potri.016G011200.1Potri.016G011400.2Potri.016G011400.1
Potri.010G155600.1Potri.006G014300.1Potri.T008900.1Potri.006G014100.2Potri.006G014100.1
Prunus persicappa000854mppa000741mppa000742mppa001005mppa000698m
ppa001122mppa001161mppa026371mppa017351mppa000939m
ppa000808mppa015564mppa001834mppa003884mppa021182m
Ricinus communis27894.m00077429628.m00076427894.m00077527894.m00077830026.m001493
29618.m00010230026.m001490.397.56830026.m001490.397.56830026.m00149230026.m001491
Setaria italicaSi016192mSi016254mSi016251mSi028799mSi028810m
Sorghum bicolorSb04g008350.1
Thellungiella halophilaThhalv10011204mThhalv10006670mThhalv10007070mThhalv10006761mThhalv10012029m
Thhalv10006680mThhalv10019958m
Vitis viniferaGSVIVT01014147001GSVIVT01014138001GSVIVT01014149001GSVIVT01014145001GSVIVT01014150001
GSVIVT01014134001GSVIVT01021289001GSVIVT01021285001GSVIVT01021291001GSVIVT01014128001
GSVIVT01021286001GSVIVT01014120001GSVIVT01014117001GSVIVT01034309001GSVIVT01014113001
GSVIVT01014110001GSVIVT01020786001GSVIVT01021278001GSVIVT01021297001GSVIVT01021293001
GSVIVT01021282001GSVIVT01000677001GSVIVT01021283001GSVIVT01021280001GSVIVT01001886001
GSVIVT01034320001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)