y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g37490.2
FamilyAA4
Protein PropertiesLength: 634 Molecular Weight: 69730.9 Isoelectric Point: 7.6349
ChromosomeChromosome/Scaffold: 01 Start: 49841545 End: 49848877
DescriptionFAD-linked oxidases family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA41763792e-21
  RYLEGILGSKNVVQDEDKLVTSNTDWMHKYKGSSKLLLQPRTADQVSQILKYCNSRNLAVVPQGGNTGLVGGSVPVFDEVIVSLSSMNKIISFDKVSGIL
  VCEAGCILENIMSFLDNEGFIMPLDLGAKGSCQIGGNVSTNAGGLRLVRYGSLHGSVLGVEAVLANGTVLDMLKTLRKDNTGYDLKHLFIGSEGSLGIVT
  KVSI
Full Sequence
Protein Sequence     Length: 634     Download
MVPGTCSVSE LRTSEPPSLT PSKIHTQPPL SIIFNPIPKY RNVTNLTLCA SAAIVHRKLP    60
NKFEAEPETM ANHNSRFLLR SFIPFFHRRM NSPLLPSATS CPRLTSGTAF DEKFTQLPSN    120
IVRGDHRQVL SFFNPSRNFA ETKQWGVGIR HKCFGSMAGS VQRNPRFSKL NDDDVRYLEG    180
ILGSKNVVQD EDKLVTSNTD WMHKYKGSSK LLLQPRTADQ VSQILKYCNS RNLAVVPQGG    240
NTGLVGGSVP VFDEVIVSLS SMNKIISFDK VSGILVCEAG CILENIMSFL DNEGFIMPLD    300
LGAKGSCQIG GNVSTNAGGL RLVRYGSLHG SVLGVEAVLA NGTVLDMLKT LRKDNTGYDL    360
KHLFIGSEGS LGIVTKVSIL TPPKLSSVNV AFLACKDYSS CQKLLQEAKG KLGEILSAFE    420
FLDVQSMNLV LNHMEGARNP LPSLHNFYVL IETTGSDESS DKQKLEAFLL GSMENELISD    480
GVLAQDINQA SSFWLLREGI PEALMRAGAV YKYDLSIPLE HMYNLVEEMR SRLGNTANVI    540
GYGHLGDGNL HLNISTSHYD DKILSHIEPY VYEWTSKHRG SISAEHGLGL MKANEIFYSK    600
SHETVQVMAS IKNLLDPNHI LNPYKVLPQS LIS*                                660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01565FAD_binding_43.0e-37210346137+
PLN02805PLN028055.0e-39203628444+
pfam02913FAD-oxidase_C2.0e-56384626251+
TIGR00387glcD2.0e-71215625423+
COG0277GlcD6.0e-110177628463+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB16815.1015063342523actin interacting protein [Arabidopsis thaliana]
RefSeqNP_568003.208263312558FAD linked oxidase family protein [Arabidopsis thaliana]
RefSeqXP_002268002.1014963365550PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310828.1015163348528predicted protein [Populus trichocarpa]
RefSeqXP_002521506.1014763377564d-lactate dehydrognease 2, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3pm9_F018162724476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_E018162724476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_D018162724476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_C018162724476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_B018162724476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8387753302155430
GO8395253312045330
CO0713632831984790
CO0718242841984800
HO4192753942396300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00314.2Aquca_007_00314.4Aquca_007_00314.1Aquca_007_00314.5Aquca_007_00314.3
Arabidopsis lyrata490996
Arabidopsis thalianaAT4G36400.1AT4G36400.2AT5G06580.1
Brachypodium distachyonBradi1g56880.1
Brassica rapaBra017758
Carica papayaevm.model.supercontig_6.186
Capsella rubellaCarubv10006814m
Chlamydomonas reinhardtiiCre10.g434900.t1.3
Citrus clementinaCiclev10025317mCiclev10025522mCiclev10025687m
Citrus sinensisorange1.1g009112morange1.1g011827morange1.1g012299morange1.1g014408morange1.1g014546m
Cucumis sativusCucsa.201090.1Cucsa.201090.2
Eucalyptus grandisEucgr.I02388.1Eucgr.I02389.3Eucgr.I02389.1Eucgr.I02389.2
Fragaria vescamrna14901.1-v1.0-hybrid
Glycine maxGlyma01g37490.3
Gossypium raimondiiGorai.011G100400.1Gorai.011G100400.2
Linum usitatissimumLus10028342Lus10041792
Medicago truncatulaMedtr5g021240.1
Mimulus guttatusmgv1a003621m
Oryza sativaLOC_Os07g06890.1LOC_Os07g08950.1
Panicum virgatumPavirv00006739m
Physcomitrella patensPp1s6_281V6.1Pp1s44_301V6.1
Phaseolus vulgarisPhvul.005G099900.1
Picea abiesMA_159144g0160MA_159128g0010MA_159099g0380
Populus trichocarpaPotri.007G018600.5Potri.007G018600.3Potri.007G018600.1Potri.007G018600.2Potri.007G018600.4
Prunus persicappa003765mppa003656m
Ricinus communis29634.m002061
Setaria italicaSi029317m
Sorghum bicolorSb02g003640.1
Thellungiella halophilaThhalv10024815m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny