y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma01g45470.1
FamilyGH95
Protein PropertiesLength: 822 Molecular Weight: 91624.6 Isoelectric Point: 6.6972
ChromosomeChromosome/Scaffold: 01 Start: 55722237 End: 55727495
Description1,2-alpha-L-fucosidases
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9587810
  RNLKIRFREGGKHWTDAVPIGNGRLGAMVCGHVHSETIHLNEDTLWTGTPADYTNSKAPPALSHVRNLVHRQHYPQATAASSALTGNPSEAYLLLGDIQL
  DFDYSHLTPGLQQPYERELDLDTATVKVRYSVGDVQFTREHFASYPDQLIVTQISSSKPAKLSFTVSLLSKIINQTYVNAPNQIIMKGSCPGKRIQHNPH
  GIQFSAILDLKIGGTDGVIHILDNNKLKVEASDWAVLLLVASSSFSGPFTAPSDSKKDPTSQCFTTLSSISNVSYSHLYARHLNDYQGLFHRVSLQLMRS
  TRPNISEDRSLELKRLTSSVAHLSLVDSTVTQASTSDRVKSFQTDEDPSLVELLFQYGRYLLISSSRPGTQVANLQGIWNKDLEPVWDGAPHLNINLEMN
  YWPALPCNLSECQEPLFDYISLLSVNGSKTAHVNYQANGWVAHSKSDIWARTSAGQGDVVWALWPMGGAWLCTHLWEHYAYTMDEDFLKYKAYPLMEGCV
  SFLLSWLIEDSEGYLETNPSTSPEHYFIAPNGEPACVSQSSTMDVAIINEVFSTFLSAAEVIGRTKDNIVGEVRKAQPRLRPINIAQDGSIMEWVKDFKD
  PEVHHRHLSHLFGLFPGHTITFKETPALIEAAEKSLYKRGEEGPGWSTTWKTACWARLQNSSNAYKMIKHLINLVDPDHERPFQGGLYSNLFAAHPPFQI
  DANFGFAAAVAEMLVQSTLSDLFLLPALPWEKWPNGSLKGLKARGGTTVNIYWREGDLQEVGIWSEDQTRTTLR
Full Sequence
Protein Sequence     Length: 822     Download
MAEGRGSRNL KIRFREGGKH WTDAVPIGNG RLGAMVCGHV HSETIHLNED TLWTGTPADY    60
TNSKAPPALS HVRNLVHRQH YPQATAASSA LTGNPSEAYL LLGDIQLDFD YSHLTPGLQQ    120
PYERELDLDT ATVKVRYSVG DVQFTREHFA SYPDQLIVTQ ISSSKPAKLS FTVSLLSKII    180
NQTYVNAPNQ IIMKGSCPGK RIQHNPHGIQ FSAILDLKIG GTDGVIHILD NNKLKVEASD    240
WAVLLLVASS SFSGPFTAPS DSKKDPTSQC FTTLSSISNV SYSHLYARHL NDYQGLFHRV    300
SLQLMRSTRP NISEDRSLEL KRLTSSVAHL SLVDSTVTQA STSDRVKSFQ TDEDPSLVEL    360
LFQYGRYLLI SSSRPGTQVA NLQGIWNKDL EPVWDGAPHL NINLEMNYWP ALPCNLSECQ    420
EPLFDYISLL SVNGSKTAHV NYQANGWVAH SKSDIWARTS AGQGDVVWAL WPMGGAWLCT    480
HLWEHYAYTM DEDFLKYKAY PLMEGCVSFL LSWLIEDSEG YLETNPSTSP EHYFIAPNGE    540
PACVSQSSTM DVAIINEVFS TFLSAAEVIG RTKDNIVGEV RKAQPRLRPI NIAQDGSIME    600
WVKDFKDPEV HHRHLSHLFG LFPGHTITFK ETPALIEAAE KSLYKRGEEG PGWSTTWKTA    660
CWARLQNSSN AYKMIKHLIN LVDPDHERPF QGGLYSNLFA AHPPFQIDAN FGFAAAVAEM    720
LVQSTLSDLF LLPALPWEKW PNGSLKGLKA RGGTTVNIYW REGDLQEVGI WSEDQTRTTL    780
RKRIHYRGTM VTADLVSGLF YKFNGQLKCL NTCSLSEMPC S*                       840
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002270199.101081535840PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313154.1048157797predicted protein [Populus trichocarpa]
RefSeqXP_002313157.10781628836predicted protein [Populus trichocarpa]
RefSeqXP_002527475.10277517794conserved hypothetical protein [Ricinus communis]
RefSeqXP_002527476.10881735845conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B097962772A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A097962772A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_B02578152850A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_A02578152850A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eab_B02578152850A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum (Apo Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8111423184747840
EX2638603003836820
FG8398122385217580
FG8986732432965380
DY8160762913926820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma10g40690.2Glyma10g40690.3
Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)