y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma0248s00200.1
FamilyCE8
Protein PropertiesLength: 403 Molecular Weight: 44601.9 Isoelectric Point: 6.5165
ChromosomeChromosome/Scaffold: 248 Start: 65 End: 2271
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82553960
  NVTVAIDDSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSA
  GPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRD
Full Sequence
Protein Sequence     Length: 403     Download
MSEGNAGKGK KIAIIGVSTL LLVAMVVAVT IGVNLNENGS NNDIEDNKKD HVASSIKAVQ    60
TLCHPTNYEK ECEESLIAGA GNTTDPKELI KIFFNITITK IGDKLKETNI LHEIEEEPRA    120
KMALDTCKQL MDLSIGELTR SLDGINEFNL INVDKILMNL KVWLSGAVTY QDTCLDGFEN    180
TTSDAGKKMK DLLTIGMHMS SNALAIVTGL ADTVNDWNIT KSFGRRLLQD SELPSWVDQH    240
RLLNENASPF KRKPNVTVAI DDSGDFKSIN EALKQVPEKN RKPFVIYIKE GVYQEYVEVT    300
KKMTHVVFIG EGGKKTRISG NKNFIDGTNT YRTATVAIQG DHFVAINMGF ENSAGPHKHQ    360
AVALRVQADK SIFYNCSMDG YQDTLYAHTM RQFYRDAPFG IL*                      420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02314PLN023141.0e-8610396405+
pfam01095Pectinesterase1.0e-87255396142+
PLN02745PLN027452.0e-9536395376+
PLN02990PLN029908.0e-10331396378+
PLN02217PLN022172.0e-1281396401+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187212.104239641396pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002314364.104539746400predicted protein [Populus trichocarpa]
RefSeqXP_002318979.105139754406predicted protein [Populus trichocarpa]
RefSeqXP_002330222.103839738407predicted protein [Populus trichocarpa]
RefSeqXP_002512459.103639738411Pectinesterase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A1e-392543947147A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A8e-392553974146B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3uw0_A0.0000000000125539632194A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_B0.000000042563968167A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_A0.000000042563968167A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BE8076462071913970
FG98726922912290
BM7325671851903740
BE0598681831193010
FG98723422412240
Orthologous Group
SpeciesID
Panicum virgatumPavirv00036753mPavirv00067617m
Phaseolus vulgarisPhvul.005G103500.1.187.314Phvul.005G103500.1.187.314
Zea maysAC212451.4_FGT009
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny