y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g01310.2
FamilyCE8
Protein PropertiesLength: 184 Molecular Weight: 20713.3 Isoelectric Point: 8.0955
ChromosomeChromosome/Scaffold: 02 Start: 952310 End: 953528
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8921751e-28
  TTKKIYLGRAWGDYSRVIFSYTYMDNIVLPKGWSDWGDQKRDSRVYYGEYKCSGPGANLAGSVPWARVLTDEEAKPFIGMQFIE
Full Sequence
Protein Sequence     Length: 184     Download
MKQRIILWEE DAKSLCAKTE QCSACGWKEG GTSRGASHDR ISGTKAGFYG TQDTLYDHKG    60
LHYFNNCSIQ GSVLFIFGSA RSLYENCYLN STTKKIYLGR AWGDYSRVIF SYTYMDNIVL    120
PKGWSDWGDQ KRDSRVYYGE YKCSGPGANL AGSVPWARVL TDEEAKPFIG MQFIERDTWL    180
ASP*                                                                 240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02432PLN024324.0e-5231180185+
PLN02304PLN023042.0e-5340182186+
PLN02671PLN026711.0e-5530180186+
PLN02665PLN026653.0e-5640183181+
PLN02682PLN026826.0e-6940180176+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN79461.1040183203381hypothetical protein [Vitis vinifera]
RefSeqXP_001764345.1030180125310predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001769817.1030180164350predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_002320279.1040180112287predicted protein [Populus trichocarpa]
RefSeqXP_002440102.1031180225404hypothetical protein SORBIDRAFT_09g026060 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A4e-1752182131306B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A7e-1752180135308A Chain A, Pectin Methylesterase From Carrot
PDB1qjv_B0.000013791138192A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A0.000013791138192A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B0.000013791138192A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CF233090182311760
DT762805181301750
DT739130181301750
DT740801164401680
CD475178165481820
Orthologous Group
SpeciesID
Arabidopsis lyrata870009.219.302870009.219.302
Brassica rapaBra015416.190.273Bra015416.190.273Bra021217
Carica papayaevm.model.supercontig_26.307.120.240evm.model.supercontig_26.307.120.240evm.model.supercontig_3.29
Capsella rubellaCarubv10022232mCarubv10012537mCarubv10015938m
Citrus sinensisorange1.1g039106m.201.336orange1.1g039106m.201.336
Cucumis sativusCucsa.090570.1.128.230Cucsa.090570.1.128.230
Eucalyptus grandisEucgr.K02430.1
Glycine maxGlyma10g01355.1.136.260Glyma02g09535.1.161.286Glyma02g09535.1.161.286Glyma10g01355.1.136.260
Gossypium raimondiiGorai.009G272800.1.123.221Gorai.009G272800.1.123.221
Linum usitatissimumLus10036006
Malus domesticaMDP0000753730MDP0000935763MDP0000206418MDP0000161415
Medicago truncatulaMedtr7g102570.1
Mimulus guttatusmgv1a018901mmgv1a025103m.137.229mgv1a025103m.137.229
Oryza sativaLOC_Os02g46310.1
Panicum virgatumPavirv00020445m.249.342Pavirv00017728mPavirv00020445m.249.342Pavirv00029452m
Physcomitrella patensPp1s446_3V6.1.278.400Pp1s446_3V6.1.278.400
Picea abiesMA_10428207g0020MA_7274893g0010MA_10431784g0010
Populus trichocarpaPotri.011G042200.1
Ricinus communis30076.m004630
Vitis viniferaGSVIVT01001104001.139.220GSVIVT01001104001.139.220
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny