y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g02230.3
FamilyGH1
Protein PropertiesLength: 522 Molecular Weight: 59451.8 Isoelectric Point: 5.6264
ChromosomeChromosome/Scaffold: 02 Start: 1584640 End: 1590398
Descriptionbeta glucosidase 11
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1374960
  RDDFPLDFVFGSGTSAYQVEGAANKDGRTPSIWDTFAYAGYAHGENGDVACDGYHKYKEDVQLMLETGLDAYRFSISWSRLLPNGRGPVNPKGLQYYNNL
  INELISNGIQPHATLHNFDLPQVLEDEYGGWISRDIIRDFTYYAEVCFREFGDRVLYWTTVNEPNVFALGGYDQGNSPPRRCSPPFCATNDTMGNSTYEP
  YLAVHHILLSHSSAARLYWRKYRDKQHGFVGISIYTFGIFPQTNTEKDRVASQRARDFFVGWIMEPLQYGDYPISMKTNAGERIPAFTNHESKQVKGSFD
  FIGVIHYTNLNVSDNSDALKNQLRDFTADMAANIFGEDLFSNEEYLITPWGLRQELNKFKLLYGNPPIFIHENGQRTASNSSLQDVTRVKYLHGYIGSVL
  DALRDGSNIKGYFAWSFLDLFELLDGYKSSFGLYYVDRDDPELKRYPKLSAKWYNRFLKG
Full Sequence
Protein Sequence     Length: 522     Download
MMEPPQTRLM INVFIVSFLA LLVNLVVGVL GADNYSRDDF PLDFVFGSGT SAYQVEGAAN    60
KDGRTPSIWD TFAYAGYAHG ENGDVACDGY HKYKEDVQLM LETGLDAYRF SISWSRLLPN    120
GRGPVNPKGL QYYNNLINEL ISNGIQPHAT LHNFDLPQVL EDEYGGWISR DIIRDFTYYA    180
EVCFREFGDR VLYWTTVNEP NVFALGGYDQ GNSPPRRCSP PFCATNDTMG NSTYEPYLAV    240
HHILLSHSSA ARLYWRKYRD KQHGFVGISI YTFGIFPQTN TEKDRVASQR ARDFFVGWIM    300
EPLQYGDYPI SMKTNAGERI PAFTNHESKQ VKGSFDFIGV IHYTNLNVSD NSDALKNQLR    360
DFTADMAANI FGEDLFSNEE YLITPWGLRQ ELNKFKLLYG NPPIFIHENG QRTASNSSLQ    420
DVTRVKYLHG YIGSVLDALR DGSNIKGYFA WSFLDLFELL DGYKSSFGLY YVDRDDPELK    480
RYPKLSAKWY NRFLKGRRTS IVGTIELEKD PSLVFVSQLF E*                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03356BGL3.0e-13641490460+
pfam00232Glyco_hydro_14.0e-15336496470+
PLN02998PLN02998035496464+
PLN02849PLN02849033499470+
PLN02814PLN02814033496466+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI36851.103551270546unnamed protein product [Vitis vinifera]
Swiss-ProtQ8S3J3015111512HIUH_SOYBN RecName: Full=Hydroxyisourate hydrolase; Short=HIU hydrolase; Short=HIUHase; Flags: Precursor
RefSeqXP_002268147.102952034527PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002523072.102551613503beta-glucosidase, putative [Ricinus communis]
RefSeqXP_002523075.10145124497beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A03649513487A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3gnp_A03649513487A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3gno_A03649513487A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_B03649430503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_A03649430503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
urate degradation to allantoin3.5.2.17-RXNEC-3.5.2.17hydroxyisourate hydrolase
Transmembrane Domains
StartEnd
1332
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FK0198842621073680
CB894344298353320
FK01574125412540
FK01595624412440
CV705614293353270
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00732.1Aquca_015_00033.2Aquca_015_00033.1Aquca_003_00738.1Aquca_003_00734.1
Aquca_018_00002.1Aquca_003_00738.2Aquca_003_00736.1Aquca_003_00738.4Aquca_003_00738.3
Aquca_003_00738.5Aquca_003_00733.2Aquca_003_00733.1Aquca_003_00735.1Aquca_003_00735.2
Aquca_003_00731.1Aquca_003_00734.3Aquca_003_00730.1Aquca_003_00734.2Aquca_003_00735.3
Aquca_003_00733.3Aquca_029_00030.1Aquca_003_00732.2Aquca_015_00029.1Aquca_029_00032.2
Aquca_015_00035.1Aquca_003_00738.7Aquca_015_00034.1Aquca_029_00032.1Aquca_003_00738.6
Aquca_003_00733.4Aquca_003_00734.5Aquca_003_00734.4Aquca_007_00054.1Aquca_003_00738.8
Aquca_003_00738.9Aquca_003_00738.11Aquca_003_00738.10Aquca_035_00146.2Aquca_035_00146.1
Aquca_015_00035.3Aquca_003_00738.12Aquca_015_00033.3Aquca_015_00035.4Aquca_015_00034.2
Aquca_015_00035.2Aquca_003_00738.13Aquca_007_00054.2Aquca_003_00738.15Aquca_003_00738.14
Aquca_003_00733.5Aquca_035_00146.3Aquca_015_00030.1Aquca_003_00735.4
Arabidopsis lyrata491999314159486775878433907850
326101315311486774492664315321
875932
Arabidopsis thalianaAT1G02850.2AT1G02850.5AT4G27830.1AT1G02850.4AT1G02850.3
AT1G02850.1AT4G22100.1AT4G27820.1AT1G45191.2AT1G45191.1
AT1G60090.1AT3G62750.1AT3G62740.1AT1G60260.1AT1G60270.1
AT5G16580.1
Brachypodium distachyonBradi2g59650.1Bradi2g27770.1Bradi3g45627.1Bradi2g59660.1Bradi3g45650.1
Bradi3g45640.1Bradi4g34927.1Bradi4g34950.1Bradi4g34940.1Bradi4g34940.3
Bradi2g09200.1Bradi3g45607.1Bradi4g34940.4Bradi2g09187.1Bradi4g34940.2
Brassica rapaBra033352Bra007699Bra000461.210.665Bra007698Bra034697
Bra014395Bra006755Bra015094Bra021441Bra006756
Bra013234Bra030064Bra015096
Carica papayaevm.TU.contig_25278.3evm.model.supercontig_9.230
Capsella rubellaCarubv10004624mCarubv10007006mCarubv10013516mCarubv10008974mCarubv10011227m
Carubv10017050mCarubv10018691mCarubv10017328m
Citrus clementinaCiclev10019719mCiclev10019788mCiclev10029910mCiclev10028386mCiclev10020433m
Ciclev10020639mCiclev10020770m
Citrus sinensisorange1.1g012181morange1.1g015605morange1.1g015785morange1.1g046009morange1.1g018009m
orange1.1g017505morange1.1g024821morange1.1g020989morange1.1g013298m.26.240orange1.1g013298m.26.240
Cucumis sativusCucsa.097180.1Cucsa.336940.1Cucsa.336950.1
Eucalyptus grandisEucgr.J00646.1Eucgr.J00645.2Eucgr.J00645.1Eucgr.K03473.1Eucgr.J00648.1
Eucgr.J00645.3Eucgr.J00647.1
Fragaria vescamrna03448.1-v1.0-hybridmrna03449.1-v1.0-hybrid
Glycine maxGlyma14g39230.1Glyma16g19480.1Glyma07g18410.1Glyma07g18400.1Glyma02g02230.4
Glyma02g17490.2Glyma14g39230.2Glyma02g02230.2
Gossypium raimondiiGorai.009G076100.2Gorai.009G076100.1
Linum usitatissimumLus10007871Lus10007872
Malus domesticaMDP0000212560MDP0000135510MDP0000938307
Manihot esculentacassava4.1_032290mcassava4.1_005780mcassava4.1_006332mcassava4.1_022817m
Medicago truncatulaMedtr5g068740.1Medtr1g088610.1Medtr4g016920.1Medtr1g088630.2Medtr1g088630.1
Medtr1g088630.3Medtr1g088630.4Medtr1g088630.5Medtr1g088630.6
Mimulus guttatusmgv1a007433m
Oryza sativaLOC_Os09g33680.1LOC_Os05g30350.1LOC_Os05g30280.3LOC_Os05g30250.1LOC_Os01g59819.1
LOC_Os01g59840.1LOC_Os01g70520.1LOC_Os09g33690.2LOC_Os05g30350.2LOC_Os05g30300.1
LOC_Os09g33710.1LOC_Os05g30280.1LOC_Os09g33680.2LOC_Os01g70520.2LOC_Os09g33690.1
LOC_Os05g30390.1LOC_Os09g33690.4LOC_Os05g30250.2LOC_Os09g33690.3
Panicum virgatumPavirv00030236mPavirv00034053mPavirv00007719mPavirv00011930mPavirv00060992m
Pavirv00043199mPavirv00052823mPavirv00060993mPavirv00000833mPavirv00012938m
Pavirv00034054mPavirv00034055mPavirv00000834mPavirv00004602mPavirv00000835m
Phaseolus vulgarisPhvul.007G145900.1Phvul.008G097600.1Phvul.008G097700.1Phvul.008G097200.1Phvul.008G097000.1
Phvul.008G097100.1Phvul.008G097100.3Phvul.008G097100.2Phvul.008G097300.1
Picea abiesMA_10434198g0010.219.693MA_10434198g0010.219.693MA_139193g0010MA_10436515g0030MA_12813g0010
Prunus persicappa004484mppa006167mppa019582mppa015330m
Ricinus communis29986.m00160629986.m00160129986.m00160329986.m00160229986.m001604
Setaria italicaSi021753mSi021785mSi001092mSi013564mSi032721m
Si013822mSi029509mSi001840mSi002332m
Sorghum bicolorSb02g029640.4Sb02g029640.3Sb02g029640.2Sb03g037780.1Sb09g018160.1
Sb09g018180.2Sb09g018180.1Sb02g029640.1Sb10g022300.1Sb02g029620.1
Thellungiella halophilaThhalv10005908mThhalv10024994mThhalv10004056mThhalv10002493mThhalv10028552m
Thhalv10002501mThhalv10006510mThhalv10004297mThhalv10003058mThhalv10006515m
Vitis viniferaGSVIVT01028006001.499.961GSVIVT01028006001.499.961GSVIVT01028004001.196.654GSVIVT01028004001.196.654GSVIVT01028004001.196.654
GSVIVT01028006001.29.484GSVIVT01028006001.29.484GSVIVT01028001001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)