y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g03820.1
FamilyGT20
Protein PropertiesLength: 861 Molecular Weight: 97435 Isoelectric Point: 6.9182
ChromosomeChromosome/Scaffold: 02 Start: 3048314 End: 3053737
Descriptiontrehalose-phosphatase/synthase 9
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT20535450
  SSGYRERKILVANMLPLQAKRDIETGKWCFSLDEDSILLQLKDGFSSDTEVIYVGSLKVEIDAHEQEQVAQKLLEDFNCIPTFLPHDVQKKFYHGFCKQQ
  LWPLFHYMLPMFPDHGDRFDRLLWQAYVSANKIFADKVMEIINPDDDFVWVQDYHLMVLPTFLRKRYNRVKLGFFLHSPFPSSEIYRTLPVRDEILRGLL
  NSDLIGFHTFDYARHFLSCCKRMLGLDYESKRGHIGLDYFGRTIFIKILPVGIHMGRLESVLNLQSTSAKLKEIQEEFKGRKVILGVDDMDIFKGISLKL
  LAVEQLLQQNRDLKGKVVLVQIVNPARSSGKDVQEAKKETYLIAQRINDTYGSINYRPVILIDRPVPRFEKSAYYAVAECCIVNAVRDGMNLVPYKYIVC
  RQGTAQMDKALARKSDSPRTSMLVVSEFIGCSPSLSGAIRVNPWNIDAVADALYSAVTMNDSEKQLRHEKHYRYISSHDVAYWARSFMQDLER
Full Sequence
Protein Sequence     Length: 861     Download
MASRSYVNLL DLAGGLLDIP HMPRTIPRIM TVPGVISDLD VYGRYDGDSD VSSSGYRERK    60
ILVANMLPLQ AKRDIETGKW CFSLDEDSIL LQLKDGFSSD TEVIYVGSLK VEIDAHEQEQ    120
VAQKLLEDFN CIPTFLPHDV QKKFYHGFCK QQLWPLFHYM LPMFPDHGDR FDRLLWQAYV    180
SANKIFADKV MEIINPDDDF VWVQDYHLMV LPTFLRKRYN RVKLGFFLHS PFPSSEIYRT    240
LPVRDEILRG LLNSDLIGFH TFDYARHFLS CCKRMLGLDY ESKRGHIGLD YFGRTIFIKI    300
LPVGIHMGRL ESVLNLQSTS AKLKEIQEEF KGRKVILGVD DMDIFKGISL KLLAVEQLLQ    360
QNRDLKGKVV LVQIVNPARS SGKDVQEAKK ETYLIAQRIN DTYGSINYRP VILIDRPVPR    420
FEKSAYYAVA ECCIVNAVRD GMNLVPYKYI VCRQGTAQMD KALARKSDSP RTSMLVVSEF    480
IGCSPSLSGA IRVNPWNIDA VADALYSAVT MNDSEKQLRH EKHYRYISSH DVAYWARSFM    540
QDLERACKDH YTKRCWGMGL GLGFRVVSLS PGFRKLSVDH IVSAYKRTGR RAIFLDYDGT    600
IVPKSSINKT PSPEVISMLN DMCNDPKNTV FIVSGRGRDS LSDWFTSCKM IGLAAEHGYF    660
LRWSKDSEWE TSPLSPDLDW KKIVEPVMQL YTEATDGSNI ETKESALVWH HQDADPDFGS    720
CQAKELLNHL ESVLANEPAV VIRGQHIVEV KPQGLNKGLV AEKVLSTMVN DGNPPDFVMC    780
VGDDISDEDM FESILRTVSC PSLPVVPEIF ACTVGQKPSK AKYYLDDPAD VLKLLQGLGA    840
SSKPKSRHLA QFQVSFESTV *                                              900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03063PLN030636.0e-17759838813+
PLN02205PLN0220501843851+
pfam00982Glyco_transf_20058545492+
PRK14501PRK14501059838784+
cd03788GT1_TPS061544484+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005992trehalose biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAV65494.1018591860trehalose 6-phosphate synthase [Gossypium hirsutum]
GenBankAAV65495.1018601861trehalose 6-phosphate synthase [Gossypium hirsutum]
EMBLCAN78769.1018601857hypothetical protein [Vitis vinifera]
RefSeqXP_002264873.1018471844PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002521023.1018601861trehalose-6-phosphate synthase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gz5_D014354574452A Chain A, Trehalose-6-Phosphate Synthase. Otsa
PDB1gz5_C014354574452A Chain A, Trehalose-6-Phosphate Synthase. Otsa
PDB1gz5_B014354574452A Chain A, Trehalose-6-Phosphate Synthase. Otsa
PDB1gz5_A014354574452A Chain A, Trehalose-6-Phosphate Synthase. Otsa
PDB2wtx_D014354575453A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase
Metabolic Pathways
Pathway NameReactionECProtein Name
trehalose biosynthesis ITREHALOSE6PSYN-RXNEC-2.4.1.15α,α-trehalose-phosphate synthase (UDP-forming)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO777775768808430
HO779327522916120
HO7793272546088610
HO7972864723758460
HO777775801760.11
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00517.2Aquca_005_00517.1Aquca_039_00035.4Aquca_039_00035.3Aquca_039_00035.2
Aquca_039_00035.1Aquca_002_00251.3Aquca_002_00251.2Aquca_002_00251.1Aquca_002_01274.1
Aquca_025_00274.3Aquca_025_00274.2Aquca_025_00274.1Aquca_136_00003.6Aquca_136_00003.5
Aquca_136_00003.4Aquca_136_00003.3Aquca_136_00003.2Aquca_136_00003.1Aquca_126_00003.7
Aquca_126_00003.6Aquca_126_00003.5Aquca_126_00003.4Aquca_126_00003.3Aquca_136_00003.7
Aquca_126_00003.2Aquca_126_00003.1Aquca_010_00468.2
Arabidopsis lyrata329750876862470660889930894829
893529875216312668477022857882
Arabidopsis thalianaAT4G17770.1AT1G68020.2AT1G68020.1AT1G06410.1AT1G23870.1
AT1G70290.1AT1G60140.1AT2G18700.1AT1G78580.1AT1G16980.1
AT1G17000.1AT4G27550.1
Brachypodium distachyonBradi4g29730.1Bradi1g69420.2Bradi1g69420.1Bradi4g41580.1Bradi2g19710.1
Bradi2g49870.1Bradi3g35820.2Bradi3g35820.1Bradi3g53790.2Bradi3g53790.1
Bradi3g37200.1Bradi2g19640.1
Brassica rapaBra012642Bra030651Bra016328Bra004054Bra007906
Bra031526Bra017888Bra038548Bra035049Bra026011
Bra019043Bra008366Bra026010Bra015497
Carica papayaevm.model.supercontig_124.34evm.model.supercontig_2.171evm.model.supercontig_7.119evm.model.supercontig_90.21evm.model.supercontig_2573.1
evm.model.supercontig_77.64evm.model.supercontig_17.166evm.model.supercontig_17.165
Capsella rubellaCarubv10004115mCarubv10008294mCarubv10008292mCarubv10019781mCarubv10008281m
Carubv10008279mCarubv10019802mCarubv10019782mCarubv10012956mCarubv10019735m
Carubv10012173mCarubv10004177m
Chlamydomonas reinhardtiig6363.t1Cre16.g686200.t1.3Cre16.g662350.t1.3
Citrus clementinaCiclev10000377mCiclev10000249mCiclev10000248mCiclev10000247mCiclev10000246m
Ciclev10014248mCiclev10014247mCiclev10014252mCiclev10014251mCiclev10018842m
Ciclev10030692mCiclev10030691mCiclev10007549mCiclev10007428mCiclev10018748m
Ciclev10017787m.78.348Ciclev10017787m.78.348Ciclev10017787m.351.497Ciclev10017787m.351.497
Citrus sinensisorange1.1g002958morange1.1g002956morange1.1g002955morange1.1g002954morange1.1g002952m
orange1.1g002951morange1.1g002949morange1.1g002947morange1.1g003682morange1.1g004314m
orange1.1g003026morange1.1g003025morange1.1g003024morange1.1g003022morange1.1g045882m
orange1.1g044635morange1.1g003999morange1.1g002986morange1.1g002984morange1.1g002983m
orange1.1g002979morange1.1g002977morange1.1g004512morange1.1g004411morange1.1g003042m
orange1.1g002285morange1.1g005855morange1.1g003145morange1.1g003029morange1.1g002314m
orange1.1g003508morange1.1g002468m
Cucumis sativusCucsa.321970.2Cucsa.321970.1Cucsa.195700.1Cucsa.285920.3Cucsa.285920.2
Cucsa.285920.1Cucsa.047130.2Cucsa.047130.1Cucsa.197030.2Cucsa.197030.1
Cucsa.212680.2Cucsa.212680.1Cucsa.057970.2Cucsa.057970.1
Eucalyptus grandisEucgr.E00259.3Eucgr.E00259.2Eucgr.E00259.1Eucgr.D00465.1Eucgr.B02686.1
Eucgr.A01931.1Eucgr.B03950.2Eucgr.B03950.1Eucgr.B00354.1Eucgr.C00201.1
Eucgr.G02474.1Eucgr.F03232.1
Fragaria vescamrna14043.1-v1.0-hybridmrna29717.1-v1.0-hybridmrna32162.1-v1.0-hybridmrna00676.1-v1.0-hybridmrna15859.1-v1.0-hybrid
mrna04965.1-v1.0-hybridmrna27346.1-v1.0-hybridmrna24860.1-v1.0-hybrid.87.409mrna24860.1-v1.0-hybrid.87.409mrna15723.1-v1.0-hybrid
mrna24860.1-v1.0-hybrid.440.585mrna24860.1-v1.0-hybrid.440.585
Glycine maxGlyma20g25540.4Glyma20g25540.3Glyma10g41680.4Glyma10g41680.3Glyma10g41680.2
Glyma08g39870.1Glyma18g18590.1Glyma01g03870.3Glyma01g03870.2Glyma02g09480.1
Glyma07g26980.2Glyma06g42820.1Glyma12g15500.1Glyma17g07530.2Glyma17g07530.1
Glyma05g02020.3Glyma05g02020.2Glyma06g19590.1Glyma04g35190.5Glyma04g35190.4
Glyma04g35190.3Glyma04g35190.2Glyma13g01420.1Glyma13g33970.2Glyma13g33970.1
Glyma12g36280.3Glyma12g36280.2Glyma12g36280.1Glyma15g27480.4Glyma15g27480.3
Glyma15g27480.2Glyma08g12760.1Glyma05g29651.1Glyma12g36280.4
Gossypium raimondiiGorai.007G033200.3Gorai.007G033200.2Gorai.007G033200.1Gorai.004G183400.3Gorai.004G183400.2
Gorai.004G183400.1Gorai.009G160400.1Gorai.005G183800.4Gorai.005G183800.3Gorai.005G183800.2
Gorai.005G183800.1Gorai.011G037000.2Gorai.011G037000.1Gorai.001G070500.2Gorai.001G070500.1
Gorai.005G152400.4Gorai.005G152400.3Gorai.005G152400.2Gorai.005G152400.1Gorai.010G241200.3
Gorai.010G241200.2Gorai.010G241200.1Gorai.004G103500.3Gorai.004G103500.2Gorai.004G103500.1
Gorai.006G094700.5Gorai.006G094700.3Gorai.006G094700.2Gorai.009G159000.2Gorai.009G159000.1
Gorai.002G046400.7Gorai.002G046400.6Gorai.002G046400.4Gorai.002G046400.3Gorai.002G046400.2
Gorai.002G046400.1Gorai.006G094700.4Gorai.006G094700.1Gorai.009G362600.3Gorai.009G362600.2
Gorai.009G362600.1Gorai.002G046400.5Gorai.006G094700.7Gorai.006G094500.2Gorai.006G094500.1
Gorai.006G094700.6
Linum usitatissimumLus10034585Lus10005425Lus10030853Lus10021805Lus10030635
Lus10015231Lus10007311Lus10012990Lus10029258Lus10029175
Lus10020741Lus10029821Lus10015509Lus10019982Lus10013694
Lus10005559Lus10015243Lus10005412
Malus domesticaMDP0000265728MDP0000838058MDP0000278633MDP0000913703MDP0000258781
MDP0000135837MDP0000799020MDP0000856196MDP0000257194MDP0000919905
MDP0000125204MDP0000139096MDP0000267875MDP0000372287MDP0000227381.89.322
MDP0000227381.89.322MDP0000227381.319.514MDP0000227381.319.514
Manihot esculentacassava4.1_001558mcassava4.1_001584mcassava4.1_001583mcassava4.1_001537mcassava4.1_001541m
cassava4.1_001591mcassava4.1_002572mcassava4.1_001596mcassava4.1_001575mcassava4.1_001517m
cassava4.1_029065mcassava4.1_021281mcassava4.1_023440mcassava4.1_001223mcassava4.1_001215m
Medicago truncatulaMedtr8g105740.1Medtr4g080160.1Medtr4g129270.1Medtr8g087910.1Medtr8g087930.1
Medtr3g076810.1
Mimulus guttatusmgv1a001209mmgv1a001235mmgv1a001234mmgv1a001255mmgv1a001271m
mgv1a001183mmgv1a001197mmgv1a001670mmgv1a001200mmgv1a001031m
mgv1a000968mmgv1a002429m
Oryza sativaLOC_Os09g23350.1LOC_Os03g12360.2LOC_Os03g12360.1LOC_Os01g53000.2LOC_Os01g53000.1
LOC_Os05g44100.1LOC_Os01g54560.2LOC_Os01g54560.1LOC_Os08g31980.1LOC_Os09g20990.1
LOC_Os01g54560.3LOC_Os02g54820.3LOC_Os02g54820.2LOC_Os02g54820.1LOC_Os08g34580.2
LOC_Os08g34580.1LOC_Os09g25890.2LOC_Os09g25890.1LOC_Os05g44210.1
Panicum virgatumPavirv00067539mPavirv00066372mPavirv00044795mPavirv00024392mPavirv00047036m
Pavirv00020834mPavirv00063462mPavirv00028869mPavirv00028868mPavirv00061089m
Pavirv00022963mPavirv00018213mPavirv00052109mPavirv00018778mPavirv00018777m
Pavirv00042411mPavirv00039659mPavirv00039254mPavirv00047762mPavirv00007139m
Pavirv00063884mPavirv00015685m.50.390Pavirv00015685m.50.390Pavirv00001194mPavirv00063137m
Pavirv00036935mPavirv00048979mPavirv00056127mPavirv00011146mPavirv00015685m.387.510
Pavirv00015685m.387.510
Physcomitrella patensPp1s153_142V6.1Pp1s80_88V6.1Pp1s81_200V6.1Pp1s88_178V6.1Pp1s116_157V6.2
Pp1s116_157V6.1Pp1s240_110V6.3Pp1s240_110V6.2Pp1s240_110V6.1
Phaseolus vulgarisPhvul.007G031800.2Phvul.007G031800.1Phvul.003G053000.1Phvul.003G016300.1Phvul.002G072400.2
Phvul.002G072400.1Phvul.011G127700.2Phvul.011G127700.1Phvul.003G150400.1Phvul.009G180300.1
Phvul.003G198800.1Phvul.011G170300.3Phvul.011G170300.2Phvul.011G170300.1Phvul.002G243600.1
Phvul.005G076500.2Phvul.005G076500.1
Picea abiesMA_48114g0010MA_10432494g0010MA_104187g0020MA_30723g0020.43.336MA_30723g0020.43.336
MA_104187g0010MA_284462g0010MA_747988g0010MA_10436560g0010MA_159003g0170
MA_99899g0010MA_30723g0020.331.462MA_30723g0020.331.462MA_10436997g0010
Populus trichocarpaPotri.003G094500.4Potri.003G094500.3Potri.003G094500.2Potri.003G094500.1Potri.001G139500.3
Potri.001G139500.2Potri.001G139500.1Potri.004G061500.2Potri.004G061500.1Potri.010G104500.2
Potri.010G104500.1Potri.012G078500.1Potri.011G070900.3Potri.011G070900.2Potri.011G070900.1
Potri.008G136500.1Potri.015G074000.1Potri.018G097700.2Potri.018G097700.1Potri.006G175500.1
Potri.004G064600.1Potri.011G103900.2Potri.001G383600.1Potri.011G103900.1Potri.004G064600.2
Prunus persicappa001305mppa001324mppa001556mppa001295mppa001387m
ppa001301mppa001397mppa001048mppa001057m
Ricinus communis30026.m00146930147.m01397829883.m00203628863.m00008830054.m000811.220.492
30054.m000811.220.49229607.m00023230026.m00151029968.m000632.57.26329968.m000632.57.263
29968.m000632.266.45029968.m000632.266.45030054.m000811.57.22130054.m000811.57.221
Setaria italicaSi034520mSi034462mSi034211mSi000238mSi000262m
Si028904mSi028903mSi013243mSi013302mSi013282m
Si016360mSi016303mSi029345mSi029154mSi019524m
Si021103m
Selaginella moellendorffii11782280360184345171410184811
Sorghum bicolorSb02g024140.1Sb01g042380.1Sb03g034640.1Sb03g033590.1Sb09g025660.1
Sb07g020270.1Sb02g023610.1Sb04g035560.1Sb07g021920.1Sb04g001670.1
Sb09g025790.1
Thellungiella halophilaThhalv10024381mThhalv10018111mThhalv10006783mThhalv10006782mThhalv10006780m
Thhalv10006773mThhalv10018114mThhalv10023265mThhalv10022544mThhalv10018081m
Thhalv10009417mThhalv10006809mThhalv10026761m
Vitis viniferaGSVIVT01020754001GSVIVT01021260001GSVIVT01007789001GSVIVT01031857001GSVIVT01020215001.138.377
GSVIVT01020215001.138.377GSVIVT01014092001GSVIVT01013121001GSVIVT01011634001.29.229GSVIVT01011634001.29.229
GSVIVT01021312001GSVIVT01021313001GSVIVT01020215001.31.141GSVIVT01020215001.31.141GSVIVT01011634001.230.392
GSVIVT01011634001.230.392
Volvox carteriVocar20002694m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)