y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g05510.1
FamilyGH9
Protein PropertiesLength: 536 Molecular Weight: 59890.8 Isoelectric Point: 5.9925
ChromosomeChromosome/Scaffold: 02 Start: 4412626 End: 4415938
Descriptionglycosyl hydrolase 9B5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9645220
  KYASALELALQFFDVQKSGKLENKRVWWRGDSGLRDGSEENLDLSKGMYDAGDHMKFGFPLAFTATVLSWAILEYGGRMDAVKQLHYALDSLKWITDYLV
  NAHPFPEVLYIQVGDPEVDHNCWERPEDMKEKRPLTQVNSSFPGTEVAAETAAALASASLVFKEIDFAYSRILLRHAQQLFTFADAYRVSYSVSIPQVGK
  YYNSSGYGDELLWAGTWLYHATKDPSYLNYVTGQNEKAFGSLGSLSWLSWDDKHAATQVLLSRVNFFGESNIPDAENLDLQMYRETAEILMCKLLPDSPT
  ATANRTESGLIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEILYCSGKLYKPVDLRKFAISQADYVLGENPMKMSYLVGYGTQYPKYIHHRGSSIPVNA
  TTGCKDGFKWFDSPHPNPNVAFGALVGGPFFDETYNDFRNNSMQAEPTTYSSALFVALL
Full Sequence
Protein Sequence     Length: 536     Download
MEHKVNDKEP NKKHYVGALC WWLTVSIIAV LVVVAGVLSL ITKFKFGHSN SPEFTSHPTN    60
VVQKYASALE LALQFFDVQK SGKLENKRVW WRGDSGLRDG SEENLDLSKG MYDAGDHMKF    120
GFPLAFTATV LSWAILEYGG RMDAVKQLHY ALDSLKWITD YLVNAHPFPE VLYIQVGDPE    180
VDHNCWERPE DMKEKRPLTQ VNSSFPGTEV AAETAAALAS ASLVFKEIDF AYSRILLRHA    240
QQLFTFADAY RVSYSVSIPQ VGKYYNSSGY GDELLWAGTW LYHATKDPSY LNYVTGQNEK    300
AFGSLGSLSW LSWDDKHAAT QVLLSRVNFF GESNIPDAEN LDLQMYRETA EILMCKLLPD    360
SPTATANRTE SGLIWVVPWN SLQHSVASAF LAVLYSDYML TSQTEILYCS GKLYKPVDLR    420
KFAISQADYV LGENPMKMSY LVGYGTQYPK YIHHRGSSIP VNATTGCKDG FKWFDSPHPN    480
PNVAFGALVG GPFFDETYND FRNNSMQAEP TTYSSALFVA LLSGLVASSS VAWSF*        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02266PLN022667.0e-13244513479+
PLN00119PLN001196.0e-14161512462+
PLN02340PLN023403.0e-14265511453+
pfam00759Glyco_hydro_97.0e-14865513453+
PLN02345PLN02345068513446+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI17386.104851638506unnamed protein product [Vitis vinifera]
RefSeqXP_002276739.105853548524PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002307711.106353553522predicted protein [Populus trichocarpa]
RefSeqXP_002327760.105751451508predicted protein [Populus trichocarpa]
RefSeqXP_002510516.105853548522endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0655275430B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB1ksc_A0655275430B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB1ks8_A0655275430A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0645265441A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0645265441A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
1941
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EH1885863431514930
GR2182823151995130
GR2182833151995130
DY2895473211784980
DR9144442991554530
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00072.3Aquca_007_00072.2Aquca_007_00072.1
Arabidopsis lyrata472218895440
Arabidopsis thalianaAT1G75680.1AT1G19940.1
Brachypodium distachyonBradi4g36240.1Bradi1g35220.1
Brassica rapaBra025783Bra008214Bra015827Bra012198
Carica papayaevm.model.supercontig_26.31evm.model.supercontig_6.239
Capsella rubellaCarubv10020139mCarubv10008868m
Citrus clementinaCiclev10003402mCiclev10000849mCiclev10025306m
Citrus sinensisorange1.1g009846morange1.1g036398morange1.1g048736m
Cucumis sativusCucsa.342940.1
Eucalyptus grandisEucgr.I02356.1Eucgr.F01640.1
Fragaria vescamrna14858.1-v1.0-hybridmrna08501.1-v1.0-hybrid
Glycine maxGlyma02g05510.2Glyma04g02740.1Glyma06g02760.1Glyma16g23930.2
Gossypium raimondiiGorai.002G123700.1Gorai.009G195400.1Gorai.007G195700.1Gorai.010G005200.1Gorai.009G195400.2
Gorai.009G195400.3Gorai.009G195400.4
Linum usitatissimumLus10025965Lus10033156Lus10034515Lus10014265
Malus domesticaMDP0000140066.57.384MDP0000250849MDP0000140066.57.384MDP0000147635
Manihot esculentacassava4.1_005604mcassava4.1_005517mcassava4.1_005180mcassava4.1_021748m
Medicago truncatulaMedtr8g075990.1Medtr3g113720.1
Mimulus guttatusmgv1a004472mmgv1a004578m
Oryza sativaLOC_Os09g36350.2LOC_Os06g50140.1LOC_Os09g36350.1
Panicum virgatumPavirv00061954mPavirv00002469mPavirv00006523mPavirv00002468m
Physcomitrella patensPp1s308_21V6.1Pp1s60_116V6.1
Phaseolus vulgarisPhvul.009G016100.1Phvul.003G262600.1
Picea abiesMA_132273g0020
Populus trichocarpaPotri.005G115400.1Potri.005G237700.1Potri.002G023900.1
Ricinus communis30170.m01379027471.m000417
Setaria italicaSi006241mSi029476m
Selaginella moellendorffii77612144066
Sorghum bicolorSb10g030140.1Sb02g030990.1
Thellungiella halophilaThhalv10007364mThhalv10018397m
Vitis viniferaGSVIVT01018793001GSVIVT01009881001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny