y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g05940.2
FamilyAA2
Protein PropertiesLength: 190 Molecular Weight: 20568.5 Isoelectric Point: 4.6267
ChromosomeChromosome/Scaffold: 02 Start: 4768028 End: 4769332
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2541772.6e-30
  YAAQILSLHFHDYFGCDGSVLLDSSESIVNEKESNNDRDSLRGFIRECPSTVSCADILTIAASDSVVLTGGPSWLVSLGRRDSRDASISGSNNNIPASNC
  TFQILQTKFEQQGLNITDLVALSG
Full Sequence
Protein Sequence     Length: 190     Download
MANSMSFLLL LSLLAFAPLC LCNPNLQFYN NSCPQAQLIV KSILTSYFVF HPGYAAQILS    60
LHFHDYFGCD GSVLLDSSES IVNEKESNND RDSLRGFIRE CPSTVSCADI LTIAASDSVV    120
LTGGPSWLVS LGRRDSRDAS ISGSNNNIPA SNCTFQILQT KFEQQGLNIT DLVALSGILL    180
KLCLCLESF*                                                           240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase1.0e-510517773+
cd00314plant_peroxidase_like2.0e-840177158+
PLN03030PLN030302.0e-3428177162+
pfam00141peroxidase6.0e-3940177149+
cd00693secretory_peroxidase9.0e-6028177164+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB45838.1011771198hypothetical protein [Thellungiella halophila]
GenBankABG49114.1011771196peroxidase [Dimocarpus longan]
EMBLCAA66964.1011771198peroxidase [Arabidopsis thaliana]
RefSeqNP_201440.1011771198peroxidase 72 (PER72) (P72) (PRXR8) [Arabidopsis thaliana]
RefSeqXP_002521512.1011771195Peroxidase 72 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2atj_B3e-37281777169A Chain A, Recombinant Horseradish Peroxidase Complex With Benzhydroxamic Acid
PDB2atj_A3e-37281777169A Chain A, Recombinant Horseradish Peroxidase Complex With Benzhydroxamic Acid
PDB3atj_B3e-37281777169A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
PDB3atj_A3e-37281777169A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
PDB1gwt_A3e-37281777169A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FR663909163271770
FN769612163271770
FN711239163271770
FP071871163271770
FP067567163271770