y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g09350.1
FamilyCE11
Protein PropertiesLength: 311 Molecular Weight: 34144.8 Isoelectric Point: 6.5933
ChromosomeChromosome/Scaffold: 02 Start: 7325968 End: 7331879
DescriptionUDP-3-O-acyl N-acetylglycosamine deacetylase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE11223070
  QQTLADCVERQGKALHSGKVSTVRLCPERASRGRYFDFRSNFVPASVEFAQVSPLCTTLYKGGFRIRTVEHLLSALEASGVDNCRIEIEDSDTQGHDAEI
  PIFDGSAREWVAAVEEVGLTVATDLDGKSVEKMAPHVNEPVYAWRNDSFVAAFPSEVVRITYGINFSQAPVIGCQWFSTPPLDNLVYSMQIALSRTFCIY
  EEVEQMRNAGLIKGGSLENAIVCSASKGWLNPPLHFSDEPCRHKILDLIGDLSLFAQFGNQGLPVAHIVAYKGGHALHTDLARRLI
Full Sequence
Protein Sequence     Length: 311     Download
MSSSNALRSS KLVSWNRTGR LQQTLADCVE RQGKALHSGK VSTVRLCPER ASRGRYFDFR    60
SNFVPASVEF AQVSPLCTTL YKGGFRIRTV EHLLSALEAS GVDNCRIEIE DSDTQGHDAE    120
IPIFDGSARE WVAAVEEVGL TVATDLDGKS VEKMAPHVNE PVYAWRNDSF VAAFPSEVVR    180
ITYGINFSQA PVIGCQWFST PPLDNLVYSM QIALSRTFCI YEEVEQMRNA GLIKGGSLEN    240
AIVCSASKGW LNPPLHFSDE PCRHKILDLI GDLSLFAQFG NQGLPVAHIV AYKGGHALHT    300
DLARRLIGMI *                                                         360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13188PRK131881.0e-6322310327+
TIGR00325lpxC5.0e-7122307292+
COG0774LpxC3.0e-7820307301+
pfam03331LpxC9.0e-8322307293+
PRK13186lpxC2.0e-9622306296+
Gene Ontology
GO TermDescription
GO:0008759UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD94001.10930626323hypothetical protein [Arabidopsis thaliana]
EMBLCBI26831.1023095312unnamed protein product [Vitis vinifera]
RefSeqNP_173874.20930626323UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana]
RefSeqNP_173884.50930669366UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana]
RefSeqXP_002281269.1022935296PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xxe_A3e-37213063263A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB1yhc_B3e-36213062262A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB1yhc_A3e-36213062262A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB1yh8_B3e-36213062262A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB1yh8_A3e-36213062262A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
Metabolic Pathways
Pathway NameReactionECProtein Name
lipid IVA biosynthesisUDPACYLGLCNACDEACETYL-RXNEC-3.5.1.108UDP-3-O-acyl-N-acetylglucosamine deacetylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV26292822412240
CA7837202091033110
FG823614242482890
FC46200523912390
FG933373227112370
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00088.3Aquca_091_00088.2Aquca_091_00088.1
Arabidopsis lyrata472870
Arabidopsis thalianaAT1G25054.1AT1G24793.2AT1G25210.2AT1G24793.1AT1G24880.1
AT1G25054.2AT1G25145.1AT1G25210.1
Brachypodium distachyonBradi1g69490.1
Brassica rapaBra010979
Carica papayaevm.model.supercontig_2.193
Capsella rubellaCarubv10009664m
Chlamydomonas reinhardtiiCre16.g653350.t1.2
Citrus clementinaCiclev10015996mCiclev10015964m
Citrus sinensisorange1.1g042138m
Cucumis sativusCucsa.188640.1Cucsa.188650.1
Eucalyptus grandisEucgr.B02675.2Eucgr.B02675.1
Gossypium raimondiiGorai.002G172000.4Gorai.002G172000.5Gorai.002G172000.3Gorai.002G172000.1Gorai.002G172000.2
Gorai.002G172000.6Gorai.001G151600.1Gorai.010G050600.1Gorai.005G149500.1Gorai.005G145500.1
Gorai.009G391300.3Gorai.009G391300.2Gorai.009G391300.1Gorai.007G245600.1
Linum usitatissimumLus10003708Lus10001592
Malus domesticaMDP0000319902MDP0000264715MDP0000150490
Manihot esculentacassava4.1_012733m
Mimulus guttatusmgv1a025203m
Oryza sativaLOC_Os03g12320.3LOC_Os03g12320.2LOC_Os03g12320.1
Panicum virgatumPavirv00014435mPavirv00025226m
Physcomitrella patensPp1s1_376V6.1
Phaseolus vulgarisPhvul.003G019200.2Phvul.003G019200.1
Picea abiesMA_159099g0220MA_10433938g0010
Populus trichocarpaPotri.010G106400.1Potri.010G106400.2Potri.T177300.1Potri.010G106400.3
Prunus persicappa009014m
Ricinus communis29673.m000948
Setaria italicaSi036592mSi010565mSi036620m
Selaginella moellendorffii117127
Sorghum bicolorSb01g042410.1
Thellungiella halophilaThhalv10007963m
Vitis viniferaGSVIVT01011660001
Volvox carteriVocar20012425m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny