y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g09535.1
FamilyCE8
Protein PropertiesLength: 299 Molecular Weight: 33277.4 Isoelectric Point: 7.8191
ChromosomeChromosome/Scaffold: 02 Start: 7461354 End: 7464320
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8711629.7e-27
  IIVDLSGNGDFSTIQSAIDSISSDNKNWVYIYVKAGTYREKVKISFDKPFIVLEGEGQKNTFVEWDDHDSSAESPTFTTMADNVVVKSISFR
CE81612861.3e-38
  FRDCTISAIDANLGPGIIGFITAQGRTDPNDSNGFVFKQCNIIGNGTTYLGRPWRGYARVIFYNTKMSNIIQPLGWQPWGFAGQEDHITFAEYGNSGPGS
  DTSKRVSWLKNLDSSTVSKMASTSFI
Full Sequence
Protein Sequence     Length: 299     Download
ELNFSALKKL VFSLAITMYL GWYLLTFFFF LTSVKIVLVH ANHNHHHHHH HEQRNNKQIA    60
NKTSHSSSGT IIVDLSGNGD FSTIQSAIDS ISSDNKNWVY IYVKAGTYRE KVKISFDKPF    120
IVLEGEGQKN TFVEWDDHDS SAESPTFTTM ADNVVVKSIS FRDCTISAID ANLGPGIIGF    180
ITAQGRTDPN DSNGFVFKQC NIIGNGTTYL GRPWRGYARV IFYNTKMSNI IQPLGWQPWG    240
FAGQEDHITF AEYGNSGPGS DTSKRVSWLK NLDSSTVSKM ASTSFIGTDG WLKTLTQL*     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02682PLN026826.0e-4470294300+
PLN02497PLN024979.0e-457016192+
PLN02176PLN021761.0e-4670295302+
pfam01095Pectinesterase4.0e-4871289299+
PLN02497PLN024975.0e-61161295135+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002263748.14e-297016131122PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002263748.10161292193324PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323773.10712931285predicted protein [Populus trichocarpa]
RefSeqXP_002330032.107029538322predicted protein [Populus trichocarpa]
RefSeqXP_002518106.107029347332Pectinesterase U1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A5e-22158296164312A Chain A, Pectin Methylesterase From Carrot
PDB1gq8_A0.00000271173996A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A6e-18158268160277B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1xg2_A0.0000272169688B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Transmembrane Domains
StartEnd
1032
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EY7048141211732933.00018e-42
EC911382113531637e-40
EC911727112531625e-39
BE4345831361572922e-38
CO9117121321612921e-36
Orthologous Group
SpeciesID
Arabidopsis lyrata870009.219.302870009.219.302
Brassica rapaBra015416.190.273Bra015416.190.273Bra021217
Carica papayaevm.model.supercontig_26.307.120.240evm.model.supercontig_26.307.120.240evm.model.supercontig_3.29
Capsella rubellaCarubv10022232mCarubv10012537mCarubv10015938m
Citrus sinensisorange1.1g039106m.201.336orange1.1g039106m.201.336
Cucumis sativusCucsa.090570.1.128.230Cucsa.090570.1.128.230
Eucalyptus grandisEucgr.K02430.1
Glycine maxGlyma10g01355.1.136.260Glyma02g09535.1.161.286Glyma02g09535.1.161.286Glyma02g01310.2Glyma10g01355.1.136.260
Gossypium raimondiiGorai.009G272800.1.123.221Gorai.009G272800.1.123.221
Linum usitatissimumLus10036006
Malus domesticaMDP0000753730MDP0000935763MDP0000206418MDP0000161415
Medicago truncatulaMedtr7g102570.1
Mimulus guttatusmgv1a018901mmgv1a025103m.137.229mgv1a025103m.137.229
Oryza sativaLOC_Os02g46310.1
Panicum virgatumPavirv00020445m.249.342Pavirv00017728mPavirv00020445m.249.342Pavirv00029452m
Physcomitrella patensPp1s446_3V6.1.278.400Pp1s446_3V6.1.278.400
Picea abiesMA_10428207g0020MA_7274893g0010MA_10431784g0010
Populus trichocarpaPotri.011G042200.1
Ricinus communis30076.m004630
Vitis viniferaGSVIVT01001104001.139.220GSVIVT01001104001.139.220
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny