y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g10150.3
FamilyGT2
Protein PropertiesLength: 334 Molecular Weight: 38076.2 Isoelectric Point: 8.7637
ChromosomeChromosome/Scaffold: 02 Start: 8033949 End: 8038769
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2652616.9e-32
  SLIIPAFNEEHRLPGALEETMNYLHQRTLKDSSFTYEVVIIDDGSADETKRVAFEFVRKYTVDKVRVILLGRNHGKGEAIRKGMMHSRGELLLMLDADGA
  TKVTDLEKLENQIQAVAKREYHHGDSSDSDPRFRISDIPAAVFGSRAHLEEKALATRKWYRNFLMKGFHLVVLMAAGPGICDTQCGFKMFTRAAARK
Full Sequence
Protein Sequence     Length: 334     Download
MDYICFFVTF TAIALLGFVS VVFFEAYKRR NNHQHIEVPA IFEDPSSLKQ VPCPHIVDPA    60
TKYISLIIPA FNEEHRLPGA LEETMNYLHQ RTLKDSSFTY EVVIIDDGSA DETKRVAFEF    120
VRKYTVDKVR VILLGRNHGK GEAIRKGMMH SRGELLLMLD ADGATKVTDL EKLENQIQAV    180
AKREYHHGDS SDSDPRFRIS DIPAAVFGSR AHLEEKALAT RKWYRNFLMK GFHLVVLMAA    240
GPGICDTQCG FKMFTRAAAR KLFSNVRLKR WCFDVELVFL CKWFRISISE ISVNWSEIPG    300
SKVNLLSIPN MLWELVLMSV GYRTGMWRIS NSA*                                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06442DPM1_like2.0e-1966291226+
pfam00535Glycos_transf_24.0e-2265263199+
cd04179DPM_DPG-synthase_like7.0e-4766281216+
PTZ00260PTZ002601.0e-8828332310+
cd04188DPG_synthase2.0e-9666302237+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_181493.102832932333glycosyl transferase family 2 protein [Arabidopsis thaliana]
RefSeqXP_002283615.102633030335PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312095.102632930333predicted protein [Populus trichocarpa]
RefSeqXP_002315224.102733131335predicted protein [Populus trichocarpa]
RefSeqXP_002530857.102832932333Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3bcv_B0.000664162794A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis
PDB3bcv_A0.000664162794A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis
PDB3ckv_A0.00076016246141A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis
PDB3ckq_A0.00076016246141A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis
PDB3cko_A0.00076016246141A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesis2.4.1.117-RXNEC-2.4.1.117dolichyl-phosphate β-glucosyltransferase
Transmembrane Domains
StartEnd
426
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE70082628412840
FE70082926012600
FS360006255442980
DV712496305163200
GW88665924912490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00165.2Aquca_011_00165.3Aquca_011_00165.4Aquca_011_00165.1
Arabidopsis lyrata482983
Arabidopsis thalianaAT2G39630.2AT2G39630.1
Brachypodium distachyonBradi1g03660.1
Brassica rapaBra005029Bra000139
Carica papayaevm.model.supercontig_1.403
Capsella rubellaCarubv10023563m
Chlamydomonas reinhardtiiCre16.g652850.t1.2
Citrus clementinaCiclev10032053m
Citrus sinensisorange1.1g027065morange1.1g019818morange1.1g023346m
Cucumis sativusCucsa.010820.1Cucsa.165370.1Cucsa.165370.2Cucsa.165370.3
Eucalyptus grandisEucgr.G02933.1Eucgr.G02933.2Eucgr.G02933.3
Fragaria vescamrna26609.1-v1.0-hybrid
Glycine maxGlyma02g10150.1Glyma18g52810.2Glyma18g52810.1Glyma02g10150.2
Gossypium raimondiiGorai.011G260700.2Gorai.009G319400.2Gorai.009G319400.4Gorai.011G260700.3Gorai.011G260700.1
Gorai.009G319400.1Gorai.009G319400.3
Linum usitatissimumLus10005164Lus10001691Lus10023414Lus10040296
Malus domesticaMDP0000274007MDP0000272852
Manihot esculentacassava4.1_011328m
Medicago truncatulaMedtr7g026260.2Medtr7g026260.1
Mimulus guttatusmgv1a025143m
Oryza sativaLOC_Os03g60700.1LOC_Os03g60700.2
Panicum virgatumPavirv00060983mPavirv00063183m
Physcomitrella patensPp1s49_46V6.1Pp1s14_205V6.2Pp1s14_205V6.1Pp1s96_201V6.1
Phaseolus vulgarisPhvul.008G010800.1Phvul.008G010800.2
Picea abiesMA_10347707g0010MA_10428813g0010MA_159008g0490MA_158860g0090
Populus trichocarpaPotri.010G204000.4Potri.010G204000.2Potri.010G204000.1Potri.008G055700.1Potri.010G204000.3
Potri.008G055700.2
Prunus persicappa008313m
Ricinus communis30003.m000334
Setaria italicaSi036396m
Selaginella moellendorffii73379414988101926
Sorghum bicolorSb01g003140.1
Thellungiella halophilaThhalv10016901m
Vitis viniferaGSVIVT01016551001
Volvox carteriVocar20012273m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny