y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g11180.1
FamilyGT19
Protein PropertiesLength: 482 Molecular Weight: 53785.2 Isoelectric Point: 9.4781
ChromosomeChromosome/Scaffold: 02 Start: 9365565 End: 9371178
Descriptiontransferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT19574370
  VFLVAGEVSGDSIASRLMASLKILSPLPIRFAGVGGVKMTSEGLQSLFPIEDISVMGLWELLPHLYRIRVKLNETVKAAALFEPHVVLTIDSKGFSFRFL
  KQLRARYRQKKLHSPAHFHYVAPSFWAWKGGETRLRGLAEFVDHLLCILPNEDKICRLNGLCATFVGHPVLEDVLELNLRNNSSIHEWKAEGNGEDFRIK
  HAVPAGATIISLLPGSRMQEVSRMLPIFSNTVELMKDMVPQLMTIIHVAPNEHVENFIADAVHRWPVPVVLIPGGTTQLRYDAFSASRAALCTSGTVAVE
  LQLARLPCVVAYRAHILTEWYIWYKAKIQYISLTNILLDKAIIPEALFQSCKPLNLALLLKDLLHDDGCREEQIIAAQKIL
Full Sequence
Protein Sequence     Length: 482     Download
MLSKWIPPIS LGAKSLLRRK CNLNPNPNIP RVQWFSVSSS KAAPMIEMAA RDGELRVFLV    60
AGEVSGDSIA SRLMASLKIL SPLPIRFAGV GGVKMTSEGL QSLFPIEDIS VMGLWELLPH    120
LYRIRVKLNE TVKAAALFEP HVVLTIDSKG FSFRFLKQLR ARYRQKKLHS PAHFHYVAPS    180
FWAWKGGETR LRGLAEFVDH LLCILPNEDK ICRLNGLCAT FVGHPVLEDV LELNLRNNSS    240
IHEWKAEGNG EDFRIKHAVP AGATIISLLP GSRMQEVSRM LPIFSNTVEL MKDMVPQLMT    300
IIHVAPNEHV ENFIADAVHR WPVPVVLIPG GTTQLRYDAF SASRAALCTS GTVAVELQLA    360
RLPCVVAYRA HILTEWYIWY KAKIQYISLT NILLDKAIIP EALFQSCKPL NLALLLKDLL    420
HDDGCREEQI IAAQKILKLL WPSERIKLNL LQQNLKTCAD YTPSAVAALT ILNHGKPMTS    480
I*                                                                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK01021lpxB7.0e-3358401354+
TIGR00215lpxB8.0e-4757409354+
pfam02684LpxB1.0e-6957445389+
PRK00025lpxB4.0e-8755477432+
COG0763LpxB8.0e-9055409357+
Gene Ontology
GO TermDescription
GO:0008915lipid-A-disaccharide synthase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI28885.10484771431unnamed protein product [Vitis vinifera]
GenBankEEC71491.104547634470hypothetical protein OsI_03760 [Oryza sativa Indica Group]
RefSeqNP_178535.203847623454transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002458499.10454729439hypothetical protein SORBIDRAFT_03g034785 [Sorghum bicolor]
RefSeqXP_002528957.103147725469Lipid-A-disaccharide synthase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
lipid IVA biosynthesisLIPIDADISACCHARIDESYNTH-RXNEC-2.4.1.182lipid-A-disaccharide synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW89340325612560
CO9817022352484820
DW017982259112640
AW5962651771983740
EY717263258953520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00075.3Aquca_006_00075.2Aquca_006_00075.1
Arabidopsis lyrata480096
Arabidopsis thalianaAT2G04560.1
Brachypodium distachyonBradi2g50040.1
Brassica rapaBra015155.41.173Bra015155.41.173Bra015155.191.448Bra015155.191.448
Carica papayaevm.model.supercontig_132.41
Capsella rubellaCarubv10016120m
Citrus clementinaCiclev10018214m
Citrus sinensisorange1.1g024872morange1.1g016179m
Cucumis sativusCucsa.139770.1
Eucalyptus grandisEucgr.K00731.1
Fragaria vescamrna01138.1-v1.0-hybrid
Gossypium raimondiiGorai.001G218100.1Gorai.001G218100.5Gorai.001G218100.6Gorai.001G218100.4Gorai.001G218100.3
Gorai.001G218100.2
Linum usitatissimumLus10035357Lus10029959
Malus domesticaMDP0000254582MDP0000227552
Manihot esculentacassava4.1_026066m
Mimulus guttatusmgv1a006184m
Oryza sativaLOC_Os01g54900.1
Panicum virgatumPavirv00020712mPavirv00034263mPavirv00034264mPavirv00034262m
Physcomitrella patensPp1s51_278V6.2Pp1s51_278V6.1Pp1s51_297V6.1Pp1s98_156V6.1
Phaseolus vulgarisPhvul.003G026900.1
Picea abiesMA_10428134g0010MA_159001g0240MA_10297492g0010
Populus trichocarpaPotri.014G160300.1
Prunus persicappa026476m
Ricinus communis56517.m00002234198.m00002229620.m000548
Selaginella moellendorffii405438
Sorghum bicolorSb03g034785.1
Thellungiella halophilaThhalv10002525m
Vitis viniferaGSVIVT01030530001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny