y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g35121.1
FamilyGT1
Protein PropertiesLength: 209 Molecular Weight: 23480.4 Isoelectric Point: 7.125
ChromosomeChromosome/Scaffold: 02 Start: 39871986 End: 39872695
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1331797.6e-27
  GSNLWKEDPKCLQWLESKESGSVVYVNFGSITVMSAEQLLEFAWGLANSKKPFLWIIRPDLVIGDRSLIASWCPQEQVLNHPCVCAGVPILCWPFFADQP
  TNCRYICNKWEIGIEIHTNVKREEVEKLVNDLMAGEKGKKMRQKIVE
Full Sequence
Protein Sequence     Length: 209     Download
MNGLSSMLPF LCTIGPFPLL LNQSPQNNFA SLGSNLWKED PKCLQWLESK ESGSVVYVNF    60
GSITVMSAEQ LLEFAWGLAN SKKPFLWIIR PDLVIGDRSL IASWCPQEQV LNHPCVCAGV    120
PILCWPFFAD QPTNCRYICN KWEIGIEIHT NVKREEVEKL VNDLMAGEKG KKMRQKIVEL    180
KKKAEEGTTP SGCSFMNLDK FIKEVLLN*                                      240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02534PLN025348.0e-3114206242+
PLN02210PLN022104.0e-331205239+
PLN02410PLN024104.0e-3725202210+
PLN02555PLN025554.0e-3711205234+
PLN02448PLN024483.0e-401205239+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2PQ601207242479A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
GenBankABD32727.101207227463UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula]
GenBankABI94024.101207242479(iso)flavonoid glycosyltransferase [Medicago truncatula]
GenBankACU24374.101207240476unknown [Glycine max]
DDBJBAF49299.101207240476putative glycosyltransferase [Clitoria ternatea]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A01207242479A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A1e-2639198254465A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A1e-2639198254465A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A1e-2639198254465A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3hbj_A1e-252205233452A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Signal Peptide
Cleavage Site
10
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GE349227216222070
FE68539923172070
HO79718023712070
GE352506208302070
CV53287822972050
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_050_00022.1Aquca_010_00166.1Aquca_010_00171.1Aquca_016_00020.1Aquca_010_00173.1
Aquca_016_00023.1Aquca_057_00092.1Aquca_028_00117.1Aquca_012_00168.1Aquca_028_00116.1
Aquca_033_00125.1Aquca_008_00276.1Aquca_010_00165.1Aquca_010_00172.1Aquca_039_00125.1
Aquca_093_00001.2Aquca_093_00001.1Aquca_016_00021.1Aquca_028_00265.1Aquca_039_00119.1
Aquca_012_00129.1Aquca_104_00008.1Aquca_028_00113.1Aquca_012_00237.1Aquca_012_00022.1
Aquca_028_00114.1Aquca_039_00120.1Aquca_010_00170.1Aquca_006_00132.1
Arabidopsis lyrata472480319356313123881781313121
335478472476472478476994
Arabidopsis thalianaAT1G22380.1AT1G22340.1AT1G78270.1AT1G22400.1AT1G22360.1
AT1G22370.1AT1G22370.2AT1G22360.2
Brachypodium distachyonBradi3g58700.1Bradi3g58680.1Bradi3g58670.1Bradi3g46855.1Bradi1g20190.1
Bradi5g11950.1Bradi5g06377.1Bradi3g46557.1Bradi3g46870.1Bradi5g08895.1
Bradi4g23757.1Bradi5g11230.1Bradi3g46547.1Bradi1g45567.1Bradi3g15935.1
Brassica rapaBra012322Bra031386Bra012323Bra031387Bra012324
Bra016382Bra031388Bra008354
Carica papayaevm.model.supercontig_36.150evm.model.supercontig_36.153evm.TU.contig_32224.1evm.model.supercontig_85.124evm.model.supercontig_85.125
evm.model.supercontig_55.73
Capsella rubellaCarubv10008992mCarubv10011877mCarubv10011262mCarubv10011467mCarubv10011698m
Carubv10009316m
Citrus clementinaCiclev10025476mCiclev10025504mCiclev10001630mCiclev10000958mCiclev10004031m
Ciclev10000925mCiclev10011540mCiclev10013430mCiclev10011729m
Citrus sinensisorange1.1g022329morange1.1g022321morange1.1g022811morange1.1g012342morange1.1g012217m
orange1.1g010775morange1.1g010684morange1.1g010825morange1.1g047540morange1.1g037221m
Cucumis sativusCucsa.104310.1Cucsa.218040.1Cucsa.311540.1Cucsa.218050.1Cucsa.218060.1
Cucsa.345730.1Cucsa.218010.1Cucsa.345720.1Cucsa.218070.1Cucsa.291510.1
Cucsa.345740.3Cucsa.345740.2Cucsa.345740.1Cucsa.358270.1
Eucalyptus grandisEucgr.I02656.1Eucgr.J01276.1Eucgr.H04754.1Eucgr.H04764.1Eucgr.H04760.1
Eucgr.H04762.1Eucgr.H04759.1Eucgr.H04756.1Eucgr.H04766.1Eucgr.I00512.1
Eucgr.L02357.1Eucgr.L00508.1Eucgr.L00503.1Eucgr.L00504.1Eucgr.L00512.1
Eucgr.L00994.1Eucgr.F00343.1Eucgr.L00991.1Eucgr.F00339.1Eucgr.F00340.1
Eucgr.F00348.1Eucgr.F00338.1Eucgr.L00599.1Eucgr.B01109.1Eucgr.F03595.1
Eucgr.E01564.1Eucgr.F00353.1Eucgr.F00337.1Eucgr.G02220.1Eucgr.G02217.1
Eucgr.L00511.1Eucgr.I02647.1Eucgr.G03386.1Eucgr.G02216.2Eucgr.G02215.2
Eucgr.L00502.1Eucgr.G02216.1Eucgr.G02215.1Eucgr.F03599.1Eucgr.F03601.1
Eucgr.F03591.1Eucgr.F03596.1Eucgr.F00346.1Eucgr.F03592.1Eucgr.F00340.2
Eucgr.E01567.1Eucgr.E01562.1Eucgr.L02355.1Eucgr.F00351.1Eucgr.F00342.1
Eucgr.F00349.1Eucgr.A01595.1
Fragaria vescamrna34573.1-v1.0-hybridmrna34574.1-v1.0-hybrid
Glycine maxGlyma02g25930.1Glyma08g19000.1Glyma13g14190.1Glyma20g05700.1Glyma18g01950.2
Glyma15g05980.1Glyma19g04570.1Glyma19g04610.1Glyma15g06000.1Glyma15g37520.1
Glyma13g01690.1Glyma14g35270.1Glyma14g35220.1Glyma14g35190.1Glyma06g10733.1
Glyma14g35160.1Glyma15g05700.1
Gossypium raimondiiGorai.003G040100.1Gorai.013G060700.1Gorai.013G060500.1Gorai.013G060400.1Gorai.009G235700.1
Linum usitatissimumLus10025741Lus10000993Lus10024584Lus10041055Lus10035903
Lus10024583Lus10032220Lus10031388Lus10032218Lus10010943
Lus10010665Lus10007421Lus10013924Lus10019364Lus10013923
Lus10017542Lus10000632Lus10013920Lus10013919Lus10013925
Lus10013921Lus10013922Lus10039277
Malus domesticaMDP0000289413MDP0000124522MDP0000134572MDP0000213111MDP0000150485
MDP0000589403MDP0000780011MDP0000682471MDP0000879480MDP0000180882
MDP0000182819MDP0000683535MDP0000504599MDP0000259360MDP0000915151
MDP0000950422MDP0000154932MDP0000177468MDP0000185209MDP0000219696
MDP0000256195MDP0000213638MDP0000196677MDP0000246186MDP0000124585
MDP0000813186MDP0000292218MDP0000498524MDP0000552871MDP0000311467
MDP0000120322MDP0000188794MDP0000841540MDP0000200450MDP0000283230
MDP0000193401MDP0000150721MDP0000133911MDP0000156988MDP0000185273
MDP0000175678MDP0000159635MDP0000176595MDP0000508014MDP0000124584
MDP0000219950MDP0000194392MDP0000299860MDP0000212461
Manihot esculentacassava4.1_026422mcassava4.1_006558mcassava4.1_006561mcassava4.1_025925mcassava4.1_006353m
cassava4.1_029261mcassava4.1_013933mcassava4.1_006649mcassava4.1_005558mcassava4.1_021191m
cassava4.1_010735mcassava4.1_006654mcassava4.1_033520mcassava4.1_031484mcassava4.1_023166m
cassava4.1_025238mcassava4.1_030305mcassava4.1_028696m
Medicago truncatulaMedtr3g079480.1Medtr1g100520.1Medtr6g014270.1Medtr6g014050.1Medtr3g008010.1
Medtr6g014250.1Medtr6g014150.1Medtr6g014190.1Medtr6g013900.1Medtr6g014470.1
Medtr6g014310.1Medtr6g014240.1Medtr6g014170.1Medtr6g014187.1Medtr5g058320.1
Medtr6g014200.1Medtr5g064240.1Medtr6g014340.1Medtr6g014290.1Medtr7g011470.1
Medtr4g094220.1Medtr6g013920.1Medtr6g013990.1Medtr6g014040.1Medtr6g014220.1
Medtr6g014020.1Medtr6g014580.1Medtr6g013960.1Medtr8g043470.1Medtr4g033620.1
Medtr2g008210.1Medtr6g014300.1
Mimulus guttatusmgv1a025300mmgv1a005711mmgv1a005587mmgv1a024760mmgv1a005689m
mgv1a005383mmgv1a005662mmgv1a018722mmgv1a025645mmgv1a006002m
mgv1a021775mmgv1a023488m
Oryza sativaLOC_Os02g51910.1LOC_Os02g51900.1LOC_Os02g51930.1LOC_Os04g25380.1LOC_Os04g25970.1
LOC_Os02g36830.1LOC_Os04g25980.1LOC_Os04g37820.1LOC_Os02g36840.1LOC_Os08g31200.1
LOC_Os04g25440.1LOC_Os04g25370.1LOC_Os04g24850.1LOC_Os04g25800.1LOC_Os02g28900.1
LOC_Os04g25490.1LOC_Os02g36810.1LOC_Os08g07200.1LOC_Os06g11720.1
Panicum virgatumPavirv00012781mPavirv00030800mPavirv00023457mPavirv00017384mPavirv00001927m
Pavirv00067140mPavirv00008304mPavirv00003072mPavirv00022369mPavirv00048885m
Pavirv00003087mPavirv00035729mPavirv00047416mPavirv00008112mPavirv00016911m
Pavirv00052190mPavirv00002582mPavirv00043932mPavirv00048044mPavirv00064463m
Pavirv00051913mPavirv00006307mPavirv00044179mPavirv00040421mPavirv00023047m
Pavirv00027257mPavirv00039402mPavirv00057091mPavirv00051079mPavirv00052414m
Pavirv00037566mPavirv00023046mPavirv00055518mPavirv00048975m
Phaseolus vulgarisPhvul.006G017500.1Phvul.008G175500.1Phvul.004G043600.1Phvul.008G175300.1Phvul.006G017600.1
Phvul.008G174700.1Phvul.006G205600.1Phvul.004G043400.1Phvul.004G043200.1Phvul.004G042900.1
Phvul.006G205500.1Phvul.006G205700.1Phvul.004G043300.1Phvul.008G175600.1Phvul.004G043500.1
Phvul.006G017400.1Phvul.011G158500.1Phvul.004G043100.1Phvul.004G043000.1
Picea abiesMA_10436276g0020MA_167914g0010MA_167603g0010MA_22116g0010MA_10434089g0020
MA_224931g0010MA_10427096g0010MA_9514701g0010MA_10434089g0010MA_10284226g0010
MA_10172523g0010MA_10431252g0010.641.827MA_10431252g0010.641.827MA_281794g0010MA_167774g0010
MA_10426668g0010MA_10436413g0010MA_95435g0010MA_3747445g0010MA_9029785g0010
MA_207926g0010.80.201MA_207926g0010.80.201MA_158653g0010MA_86064g0010MA_10426668g0020
Populus trichocarpaPotri.005G073800.1Potri.007G095000.1Potri.001G313000.1Potri.016G021500.1Potri.016G022000.1
Potri.002G098300.1Potri.006G023600.1Potri.016G022100.1Potri.006G023100.3Potri.016G022400.2
Potri.016G022400.1Potri.004G172700.2Potri.004G172700.1Potri.006G022300.1Potri.006G023700.1
Potri.017G052300.1Potri.007G132400.1Potri.T148700.1Potri.006G023100.2Potri.006G023100.1
Potri.006G022800.1Potri.002G098400.1Potri.017G052400.1Potri.016G022500.1Potri.001G312600.1
Potri.T181000.1Potri.016G021000.1Potri.016G020800.2Potri.016G020800.1Potri.017G052000.2
Potri.017G052000.1Potri.006G022500.1Potri.016G021600.1Potri.016G021100.1Potri.006G022600.1
Potri.016G020400.1Potri.017G052100.2Potri.017G052100.1Potri.016G021200.1Potri.016G021700.1
Potri.016G021800.1Potri.016G020700.1Potri.016G020900.1Potri.016G020500.1Potri.016G021300.1
Potri.006G023000.1
Prunus persicappa018343mppa021414mppa017055mppa026557mppa015357m
ppa004968mppa005043mppa023851mppa021058mppa004909m
ppa004956mppa004979mppa020820mppa004945mppa004989m
ppa018697mppa019145mppb015490m
Ricinus communis27561.m00029628492.m00046630131.m00714627956.m00035029806.m000962
27956.m00035229806.m00096329806.m00096129806.m00096429806.m000960
27956.m00034929908.m00605029848.m00468829908.m00604829908.m006049
Setaria italicaSi017031mSi017045mSi009951mSi017055mSi017025m
Si009941mSi016991mSi028377mSi028384mSi009917m
Si016809mSi017086mSi017064mSi020070mSi029646m
Si006315mSi019905mSi015022m
Sorghum bicolorSb01g001220.1Sb06g018460.1Sb04g027420.1Sb04g027460.1Sb04g027470.1
Sb04g023920.1Sb04g023930.1Sb09g023700.1Sb06g018490.1Sb10g009800.1
Sb02g030370.1Sb10g025750.1Sb07g021090.1Sb04g023530.1Sb02g039670.1
Sb10g007700.1Sb07g004500.1
Thellungiella halophilaThhalv10007502mThhalv10007489mThhalv10009957m.282.458Thhalv10009957m.282.458Thhalv10007499m
Thhalv10009957m.570.750Thhalv10009957m.570.750Thhalv10019687m
Vitis viniferaGSVIVT01015729001GSVIVT01006626001GSVIVT01009052001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)