y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g36210.4
FamilyGT41
Protein PropertiesLength: 929 Molecular Weight: 102894 Isoelectric Point: 5.9137
ChromosomeChromosome/Scaffold: 02 Start: 41577054 End: 41594665
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT413618520
  IKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGDIALAINAYEQCLKIDPDSRNAGQNRLLAMNYIDEGNDDKLFEAHR
  DWGRRFMRLYSQFTSWDNSKDPERPLVIGYVSPDYFTHSVSYFIEAPLLYHDYTNYKVVVYSAVVKADAKTIRFREKVLKKGGIWKDIYGTDEKKVADMV
  REDQVDILIELTGHTANNKLGMMACRPAPVQVTWIGYPNTTGLPTIDYRITDSQADPPETKQKHVEELVRLPDCFLCYTPSPEAGPVCPTPALSNGFVTF
  GSFNNLAKITPKVLQVWAKILCAIPNSRLVVKCKPFCCDSVRQRFLSTLEKLGLEPLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMG
  VPCVTMAGSVHAHNVGVSLLSKVGLGNLIAKNEDEYVKLAVKLASDISALQNLRMSLRELMSKSPLCNGAKFTLGLESTYRKMWRRYCKGDV
Full Sequence
Protein Sequence     Length: 929     Download
MAWTEDSDGN NGREKLVGEN GFLKVSEPSS DGSVGDGGSV SKRCEGKDDV SYANILRSRN    60
KFVDALALYE RVLESDGGNV EALIGKGICL QMQNMGRLAF ESFAEAIRLD PQNACALTHC    120
GILYKDEGRL VEAAESYQKA LQVDPSYKAA AECLAIVLTD IGTNIKLAGN TQEGIQKYFE    180
ALKIDPHYAP AYYNLGVVYS EMMQYDMALT FYEKAASERP MYAEAYCNMG VIYKNRGDLE    240
AAITCYERCL AVSPNFEIAK NNMAIALTDL GTKVKLEGDI DHGVAFYKKA LYYNWHYADA    300
MYNLGVAYGE MLKFDMAIVF YELAFHFNPH CAEACNNLGV IYKDRDNLDK AVECYQLALG    360
IKPNFSQSLN NLGVVYTVQG KMDAAASMIE KAIIANPTYA EAYNNLGVLY RDAGDIALAI    420
NAYEQCLKID PDSRNAGQNR LLAMNYIDEG NDDKLFEAHR DWGRRFMRLY SQFTSWDNSK    480
DPERPLVIGY VSPDYFTHSV SYFIEAPLLY HDYTNYKVVV YSAVVKADAK TIRFREKVLK    540
KGGIWKDIYG TDEKKVADMV REDQVDILIE LTGHTANNKL GMMACRPAPV QVTWIGYPNT    600
TGLPTIDYRI TDSQADPPET KQKHVEELVR LPDCFLCYTP SPEAGPVCPT PALSNGFVTF    660
GSFNNLAKIT PKVLQVWAKI LCAIPNSRLV VKCKPFCCDS VRQRFLSTLE KLGLEPLRVD    720
LLPLILLNHD HMQAYSLMDI SLDTFPYAGT TTTCESLYMG VPCVTMAGSV HAHNVGVSLL    780
SKVGLGNLIA KNEDEYVKLA VKLASDISAL QNLRMSLREL MSKSPLCNGA KFTLGLESTY    840
RKMWRRYCKG DVPALKRMEL LQQPVSSNDP SNKNSEPTRA TNSSEGSPGS VKANGFSSTQ    900
PPKLNFVNCE ENGGSLNHSS KQGMVGSS*                                      960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_411.0e-17486635151+
pfam13844Glyco_transf_415.0e-24658844187+
COG3914Spy9.0e-87315847562+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAX46402.1019131915putative SPINDLY protein [Rosa luciae]
RefSeqXP_002281883.1019151914PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308458.1019231931predicted protein [Populus trichocarpa]
RefSeqXP_002323412.1019051911predicted protein [Populus trichocarpa]
RefSeqXP_002530535.1019201924o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1w3b_B2e-368341537388A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B5e-275437375380A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B3e-2119543139268A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B0.00000000000431345148211A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_A2e-368341537388A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2954084014288250
HO7812093614918510
HO7812091183915080
HO781209822102880.00004
HO781209583283837.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)