y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g39680.1
FamilyGT1
Protein PropertiesLength: 470 Molecular Weight: 52587.4 Isoelectric Point: 6.1918
ChromosomeChromosome/Scaffold: 02 Start: 44917130 End: 44922308
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11004338.5e-32
  EELLNRLQPPPTAIVPDTFLYWAVAVGNRRNIPVASFWTMSASIFSVLHHHHLLVQNGHYPVNLSENGGERVDYIPGISSMRLVDFPLNDGSCRSKQLLQ
  ISLKGFEWVSKAQHLLITSIYELEPQAIDVLKAELSLPIYTIGPAIPYFSLEKNPTLSTTNGTSHSYMEWLDAQPDRSVLYISQGSYFSVSRAQVDEIAF
  ALRESDIRFLWVARSEASRLKEICGSKGLVVTWCDQLRVLSHSSIGGFWSHCGWNSTKEGVLAGVPFLTFPIIMDQPIDSKMIVEDWKVGWRVNEDVNVN
  NTLVKKDEIVMLVQKFLDLNSEHAREIRERSKTL
Full Sequence
Protein Sequence     Length: 470     Download
MESPSLSTCG CHLVAMPYPA RGHINPMMNF CKLLVSNNTG IILVTFVVTE EWLGFIGSDP    60
KPDSIRYATI PNVIPSELTR ANDHPGFMEA VMTKMEVPFE ELLNRLQPPP TAIVPDTFLY    120
WAVAVGNRRN IPVASFWTMS ASIFSVLHHH HLLVQNGHYP VNLSENGGER VDYIPGISSM    180
RLVDFPLNDG SCRSKQLLQI SLKGFEWVSK AQHLLITSIY ELEPQAIDVL KAELSLPIYT    240
IGPAIPYFSL EKNPTLSTTN GTSHSYMEWL DAQPDRSVLY ISQGSYFSVS RAQVDEIAFA    300
LRESDIRFLW VARSEASRLK EICGSKGLVV TWCDQLRVLS HSSIGGFWSH CGWNSTKEGV    360
LAGVPFLTFP IIMDQPIDSK MIVEDWKVGW RVNEDVNVNN TLVKKDEIVM LVQKFLDLNS    420
EHAREIRERS KTLRQICRRA ITNGGSAVTD LNAFVGDLMQ TNIDSMNTL*               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02534PLN025344.0e-504460502+
PLN02152PLN021523.0e-5012458476+
PLN02173PLN021734.0e-5312455466+
PLN02555PLN025555.0e-541458492+
PLN02448PLN0244807462457+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI15888.10164601440unnamed protein product [Vitis vinifera]
EMBLCBI15889.10164601440unnamed protein product [Vitis vinifera]
RefSeqXP_002273985.1014601451PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002278049.10124608451PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002278087.101146012453PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A01245910478A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B7.00649e-451246211465A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A7.00649e-451246211465A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acv_B2.94273e-441245811461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A2.94273e-441245811461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FS326704242102510
EH03938916381700
FS32042925132490
EX659985265112740
DY29405831183090
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00224.2Aquca_030_00224.1Aquca_030_00223.1Aquca_030_00247.1
Arabidopsis lyrata481926481925
Arabidopsis thalianaAT2G30150.1AT2G30140.1AT2G30140.2
Brachypodium distachyonBradi2g21317.1Bradi2g52740.1Bradi2g52750.1
Brassica rapaBra018333Bra022781Bra018334
Carica papayaevm.model.supercontig_46.189evm.model.supercontig_2.368
Capsella rubellaCarubv10023179mCarubv10023176m
Citrus clementinaCiclev10028376mCiclev10028375mCiclev10028356mCiclev10029825m
Citrus sinensisorange1.1g012096morange1.1g044218m
Cucumis sativusCucsa.139460.1Cucsa.139470.1
Eucalyptus grandisEucgr.B00404.1Eucgr.B00406.1Eucgr.J01864.1Eucgr.J01863.1Eucgr.J01875.1
Eucgr.B03993.1Eucgr.B03996.1Eucgr.J01877.1Eucgr.J01867.1Eucgr.B03994.1
Eucgr.B03997.2Eucgr.B03997.1Eucgr.J01880.1Eucgr.J01869.1Eucgr.B00411.1
Eucgr.J01874.1Eucgr.J01870.1Eucgr.B00409.1Eucgr.J01868.1Eucgr.J01873.1
Fragaria vescamrna28195.1-v1.0-hybridmrna28196.1-v1.0-hybridmrna28194.1-v1.0-hybridmrna28201.1-v1.0-hybridmrna28199.1-v1.0-hybrid
mrna28200.1-v1.0-hybridmrna28193.1-v1.0-hybrid
Glycine maxGlyma02g39700.2Glyma14g37770.1Glyma14g37730.1Glyma04g36200.1Glyma04g36200.2
Glyma02g39700.1Glyma11g29480.2
Gossypium raimondiiGorai.013G271000.1Gorai.009G113100.1Gorai.009G113100.2Gorai.013G270900.1Gorai.013G271100.1
Linum usitatissimumLus10042260Lus10026394Lus10026393Lus10042261Lus10042262
Lus10042264
Malus domesticaMDP0000593031MDP0000376869MDP0000173539MDP0000222559MDP0000686301
MDP0000396630MDP0000396403MDP0000739392.384.594MDP0000739392.384.594MDP0000263453
MDP0000317841MDP0000276057MDP0000379060MDP0000902216MDP0000156246
MDP0000313145MDP0000166802MDP0000229763MDP0000811246
Manihot esculentacassava4.1_007402mcassava4.1_007201m
Medicago truncatulaMedtr5g072810.1Medtr5g072830.1Medtr5g072820.1Medtr5g072840.1Medtr5g072860.1
Medtr3g031400.1Medtr3g031450.1Medtr5g075440.1Medtr5g072850.1
Mimulus guttatusmgv1a005987mmgv1a021616m
Oryza sativaLOC_Os01g59110.1LOC_Os01g59100.1LOC_Os05g41400.1
Panicum virgatumPavirv00005550mPavirv00033216mPavirv00018377mPavirv00053061m
Phaseolus vulgarisPhvul.008G256800.2Phvul.008G256800.1Phvul.008G256600.1Phvul.008G256600.2Phvul.008G257200.1
Picea abiesMA_10434904g0010
Populus trichocarpaPotri.001G281900.1Potri.001G282100.1Potri.009G077400.1Potri.009G077200.1Potri.009G077500.1
Potri.001G281800.1
Prunus persicappa015751mppa022795mppa024989mppa006015mppa019639m
ppa026425mppa005406m
Ricinus communis27561.m00029029628.m000755
Setaria italicaSi004951mSi024733mSi024959mSi001326m
Selaginella moellendorffii439509
Sorghum bicolorSb03g037450.1Sb03g037440.1Sb09g024190.1
Thellungiella halophilaThhalv10025222mThhalv10016641m
Vitis viniferaGSVIVT01024653001GSVIVT01024655001GSVIVT01024656001GSVIVT01024649001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)